Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6847
Gene name
LocationContig_37:14288..17221
Strand-
Gene length (bp)2933
Transcript length (bp)2577
Coding sequence length (bp)2577
Protein length (aa) 859

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 5.0E-10 192 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WDM5|GPI7_ASPFU GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=las21 PE=2 SV=1 17 846 0.0E+00
sp|Q2U9J2|GPI7_ASPOR GPI ethanolamine phosphate transferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=las21 PE=3 SV=2 17 847 0.0E+00
sp|Q6C7Q6|GPI7_YARLI GPI ethanolamine phosphate transferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LAS21 PE=3 SV=1 15 852 3.0E-160
sp|Q8TGB2|GPI7_CANAL GPI ethanolamine phosphate transferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAS21 PE=3 SV=2 24 850 3.0E-156
sp|Q6BZ57|GPI7_DEBHA GPI ethanolamine phosphate transferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LAS21 PE=3 SV=2 28 847 4.0E-153
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WDM5|GPI7_ASPFU GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=las21 PE=2 SV=1 17 846 0.0E+00
sp|Q2U9J2|GPI7_ASPOR GPI ethanolamine phosphate transferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=las21 PE=3 SV=2 17 847 0.0E+00
sp|Q6C7Q6|GPI7_YARLI GPI ethanolamine phosphate transferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LAS21 PE=3 SV=1 15 852 3.0E-160
sp|Q8TGB2|GPI7_CANAL GPI ethanolamine phosphate transferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAS21 PE=3 SV=2 24 850 3.0E-156
sp|Q6BZ57|GPI7_DEBHA GPI ethanolamine phosphate transferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LAS21 PE=3 SV=2 28 847 4.0E-153
sp|Q758B8|GPI7_ASHGO GPI ethanolamine phosphate transferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LAS21 PE=3 SV=2 24 852 2.0E-152
sp|Q6CLN2|GPI7_KLULA GPI ethanolamine phosphate transferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAS21 PE=3 SV=1 24 838 2.0E-139
sp|Q6FPB2|GPI7_CANGA GPI ethanolamine phosphate transferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LAS21 PE=3 SV=1 13 838 5.0E-139
sp|P40367|GPI7_YEAST GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAS21 PE=1 SV=1 24 842 2.0E-136
sp|Q09782|GPI7_SCHPO GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=las21 PE=3 SV=1 27 837 4.0E-129
sp|Q5H8A4|PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens GN=PIGG PE=1 SV=1 24 341 1.0E-69
sp|Q8TEQ8|PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens GN=PIGO PE=1 SV=3 59 490 1.0E-44
sp|Q9JJI6|PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus GN=Pigo PE=1 SV=2 59 365 1.0E-40
sp|O13663|GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi13 PE=3 SV=1 59 348 8.0E-40
sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI13 PE=1 SV=1 5 343 2.0E-36
sp|Q74ZS2|GPI13_ASHGO GPI ethanolamine phosphate transferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI13 PE=3 SV=2 24 343 2.0E-35
sp|O95427|PIGN_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens GN=PIGN PE=1 SV=1 50 366 4.0E-13
sp|Q9R1S3|PIGN_MOUSE GPI ethanolamine phosphate transferase 1 OS=Mus musculus GN=Pign PE=2 SV=2 50 338 6.0E-13
sp|P36051|MCD4_YEAST GPI ethanolamine phosphate transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCD4 PE=1 SV=1 38 366 2.0E-12
sp|Q6CW36|MCD4_KLULA GPI ethanolamine phosphate transferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MCD4 PE=3 SV=1 38 366 5.0E-12
sp|Q8WZK2|MCD4_SCHPO GPI ethanolamine phosphate transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=its8 PE=1 SV=1 38 365 6.0E-12
sp|Q2H0X9|MCD4_CHAGB GPI ethanolamine phosphate transferase 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MCD4 PE=3 SV=1 186 366 1.0E-11
sp|Q2U0S9|MCD4_ASPOR GPI ethanolamine phosphate transferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mcd4 PE=3 SV=1 38 366 1.0E-11
sp|Q4W9R7|MCD4_ASPFU GPI ethanolamine phosphate transferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mcd4 PE=2 SV=1 38 366 2.0E-11
sp|Q5H8A4|PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens GN=PIGG PE=1 SV=1 536 833 3.0E-11
sp|Q7SAP1|MCD4_NEUCR GPI ethanolamine phosphate transferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mcd-4 PE=3 SV=1 57 366 2.0E-10
sp|Q4ILH3|MCD4_GIBZE GPI ethanolamine phosphate transferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCD4 PE=3 SV=1 55 366 2.0E-10
sp|Q5AXD1|MCD4_EMENI GPI ethanolamine phosphate transferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mcd4 PE=3 SV=1 56 366 3.0E-10
sp|Q6C0Z3|MCD4_YARLI GPI ethanolamine phosphate transferase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MCD4 PE=3 SV=1 38 361 4.0E-10
sp|Q6BWE3|MCD4_DEBHA GPI ethanolamine phosphate transferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MCD4 PE=3 SV=2 58 366 1.0E-09
sp|Q757X5|MCD4_ASHGO GPI ethanolamine phosphate transferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MCD4 PE=3 SV=2 38 366 4.0E-09
sp|Q6FJ81|MCD4_CANGA GPI ethanolamine phosphate transferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MCD4 PE=3 SV=1 58 366 1.0E-08
sp|Q5A3M6|MCD4_CANAL GPI ethanolamine phosphate transferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCD4 PE=3 SV=1 58 338 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 449 468 19
3 475 497 22
4 640 659 19
5 709 731 22
6 751 773 22
7 794 816 22
8 831 853 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6847
MVVIEKGSFLCTLLLAVANLLIPLSVVIFATGFFPHKPTLPGLAEYEALEFGAVPRAPFDRLVFMVVDALRSDFV
YSENSGFQYTQSLIREGTAMPFTANARAPTVTMPRIKAITTGSIPSFVDLILNLDESDTSSSLAAQDTWLAQLKA
RAKGKLLMYGDDTWLKLFPDTFDRHDGTSSFFVSDFTEVDNNVTRNIAAELDNQDWSLMVLHYLGLDHIGHKAGP
RSSNMLPKQREMDGIVQTIYQAMESKHHLGSTLFVVCGDHGMNDAGNHGASSAGETSPALLFMSPKLKSIAASLP
APAQPKDEFDYYATVEQSDIAPTIAALLGFPVPKNNLGAFIPEFLPFWPDSSDKVQILIRNARQILGIVTAAFGA
DLFDTHSDIDPCNLETTDINELACQWRNISKQASSLKSAAEIDSAWLSEMSAWLRRAQELMSSMASNYNMSRLFI
GQGLAIAAALCSGAAAMLQDMQRSGNFMTLLLVTLSYGVMMFASSYVEEEQHFWYWSSTAWTAWLGSRAIRRMGR
LSSAARHTISLACLRLARSWNQTGQKFAGEPDIVKLYLAPNPQLTWLLASLPYILVGQLLLDLPGLPKPVSASLA
CALVSAAFTFKLAFTAEDAPELVLGLTKKLNDALKGPSLISRARVVFLLLAALALFALYQGRRGGGRSRSSVRLL
HHLYTLFAMTQSRATNMPLFLLASVAFRSLELDGLSVVDITISSLLLQHTFFFAFGGSNAISSIDLSSAYNGVSD
FNIAAVGFLAFVSNWAGPIFWTSATNLLLLQNDRRGQPHVYRRHLTLLTLFVTASTAFVMAACTALRTHLFIWTV
FSPKYLYSLAWSLVQHLGVNVLLGGLLFRYGAR*
Coding >Hirsu2|6847
ATGGTGGTCATAGAGAAGGGGTCATTCCTGTGCACCCTCCTGCTGGCCGTCGCCAACCTGCTCATCCCGCTGTCC
GTCGTCATCTTTGCCACCGGCTTCTTCCCTCACAAGCCTACCCTTCCAGGCTTGGCAGAATATGAGGCTCTCGAG
TTTGGCGCGGTGCCACGCGCCCCCTTTGATCGCCTCGTCTTCATGGTGGTCGACGCGTTGAGAAGCGATTTCGTC
TACTCAGAGAACTCCGGCTTCCAGTACACACAGAGTCTCATCCGTGAAGGCACCGCCATGCCCTTCACTGCCAAT
GCTCGAGCCCCAACTGTGACCATGCCGAGGATCAAGGCCATCACCACCGGATCCATCCCTTCATTCGTTGATCTT
ATACTGAACCTCGATGAGTCTGACACTTCGTCGTCACTGGCAGCTCAGGACACTTGGCTGGCCCAGCTCAAAGCC
AGGGCCAAAGGAAAGCTGCTCATGTACGGTGACGATACCTGGCTCAAGCTGTTTCCGGATACCTTTGATCGGCAC
GATGGGACTTCAAGCTTTTTCGTCTCCGACTTCACCGAGGTAGACAACAATGTCACAAGAAACATCGCTGCTGAA
CTCGATAATCAAGATTGGTCTCTCATGGTGCTACACTACCTCGGACTCGATCACATCGGCCACAAAGCGGGCCCT
AGGAGCTCCAACATGCTCCCCAAGCAGCGCGAAATGGATGGCATTGTCCAGACAATCTACCAGGCGATGGAGTCC
AAACATCACCTGGGATCGACCTTGTTTGTTGTGTGCGGCGATCACGGCATGAATGATGCGGGAAACCACGGAGCG
TCGTCTGCTGGCGAGACGTCGCCAGCCCTTCTCTTCATGTCTCCCAAGCTGAAGAGCATAGCAGCGAGTCTCCCT
GCTCCGGCTCAGCCAAAGGACGAGTTTGACTACTACGCCACTGTCGAACAGTCCGACATTGCTCCGACCATTGCT
GCGCTGCTCGGCTTTCCTGTGCCCAAGAACAATCTCGGTGCATTCATACCTGAATTTCTGCCATTCTGGCCCGAT
TCCAGTGACAAGGTTCAAATTCTCATCCGCAACGCCAGACAGATCCTTGGAATTGTAACAGCTGCCTTTGGGGCC
GACCTGTTTGACACTCACAGTGACATCGACCCGTGTAACCTGGAGACCACCGATATCAACGAGCTTGCTTGCCAA
TGGCGCAATATCAGCAAACAGGCATCTTCTTTGAAGTCTGCCGCCGAAATCGACTCTGCGTGGCTGTCGGAGATG
TCGGCTTGGTTGCGCAGGGCTCAAGAACTGATGAGCAGCATGGCTTCCAACTACAACATGAGCCGACTGTTCATC
GGCCAGGGCCTGGCCATTGCGGCTGCCCTCTGTAGCGGCGCGGCTGCGATGCTGCAAGACATGCAGCGTAGTGGA
AACTTCATGACTCTGCTGCTGGTGACTCTGTCATACGGCGTCATGATGTTTGCCAGCAGCTACGTAGAGGAGGAA
CAGCACTTCTGGTACTGGTCATCGACAGCTTGGACAGCCTGGCTCGGCTCTCGCGCCATTCGCAGGATGGGACGC
CTGTCGTCCGCTGCTCGGCACACGATTTCGCTCGCCTGCCTACGCCTCGCAAGGAGCTGGAACCAGACGGGCCAG
AAGTTCGCGGGCGAGCCCGACATCGTCAAGCTGTACCTCGCTCCCAACCCGCAGCTCACCTGGTTACTGGCCAGC
CTGCCGTACATACTGGTCGGCCAGCTGCTCCTCGATCTCCCCGGACTCCCCAAACCCGTCTCGGCCTCCCTAGCG
TGCGCACTCGTTTCCGCAGCCTTTACGTTCAAGCTAGCTTTCACTGCCGAGGATGCGCCCGAGCTTGTGTTGGGT
CTCACAAAGAAGCTGAACGACGCCTTGAAAGGTCCATCTCTGATATCAAGAGCGCGAGTCGTCTTTCTGCTGCTC
GCGGCGCTTGCGCTGTTTGCGCTGTACCAGGGGAGAAGAGGTGGAGGCCGATCAAGATCGTCAGTCCGGCTCCTC
CATCACCTCTACACGTTATTCGCGATGACGCAGTCTCGGGCGACCAACATGCCCTTGTTTCTCCTGGCCTCCGTT
GCCTTCCGCAGTCTCGAGCTCGACGGCCTTTCCGTCGTCGACATCACCATCTCGTCTCTCCTCCTCCAGCACACG
TTCTTCTTCGCCTTTGGCGGCTCCAACGCTATCTCCTCCATCGACCTGTCGAGCGCGTACAACGGCGTCAGCGAC
TTCAACATCGCGGCCGTCGGCTTCCTCGCCTTCGTCAGCAACTGGGCCGGGCCCATCTTCTGGACATCGGCCACC
AACCTGCTGCTCCTGCAGAACGACCGCAGGGGCCAGCCGCACGTCTACCGCCGCCACCTCACTCTCCTCACCCTG
TTCGTGACGGCCAGCACGGCGTTCGTCATGGCGGCCTGCACCGCACTGAGGACCCATCTGTTCATCTGGACCGTC
TTCTCGCCCAAGTACCTCTACAGCCTGGCCTGGAGTCTCGTACAGCACTTGGGCGTCAACGTGCTGCTCGGAGGG
CTTCTGTTCCGGTACGGCGCGAGGTAG
Transcript >Hirsu2|6847
ATGGTGGTCATAGAGAAGGGGTCATTCCTGTGCACCCTCCTGCTGGCCGTCGCCAACCTGCTCATCCCGCTGTCC
GTCGTCATCTTTGCCACCGGCTTCTTCCCTCACAAGCCTACCCTTCCAGGCTTGGCAGAATATGAGGCTCTCGAG
TTTGGCGCGGTGCCACGCGCCCCCTTTGATCGCCTCGTCTTCATGGTGGTCGACGCGTTGAGAAGCGATTTCGTC
TACTCAGAGAACTCCGGCTTCCAGTACACACAGAGTCTCATCCGTGAAGGCACCGCCATGCCCTTCACTGCCAAT
GCTCGAGCCCCAACTGTGACCATGCCGAGGATCAAGGCCATCACCACCGGATCCATCCCTTCATTCGTTGATCTT
ATACTGAACCTCGATGAGTCTGACACTTCGTCGTCACTGGCAGCTCAGGACACTTGGCTGGCCCAGCTCAAAGCC
AGGGCCAAAGGAAAGCTGCTCATGTACGGTGACGATACCTGGCTCAAGCTGTTTCCGGATACCTTTGATCGGCAC
GATGGGACTTCAAGCTTTTTCGTCTCCGACTTCACCGAGGTAGACAACAATGTCACAAGAAACATCGCTGCTGAA
CTCGATAATCAAGATTGGTCTCTCATGGTGCTACACTACCTCGGACTCGATCACATCGGCCACAAAGCGGGCCCT
AGGAGCTCCAACATGCTCCCCAAGCAGCGCGAAATGGATGGCATTGTCCAGACAATCTACCAGGCGATGGAGTCC
AAACATCACCTGGGATCGACCTTGTTTGTTGTGTGCGGCGATCACGGCATGAATGATGCGGGAAACCACGGAGCG
TCGTCTGCTGGCGAGACGTCGCCAGCCCTTCTCTTCATGTCTCCCAAGCTGAAGAGCATAGCAGCGAGTCTCCCT
GCTCCGGCTCAGCCAAAGGACGAGTTTGACTACTACGCCACTGTCGAACAGTCCGACATTGCTCCGACCATTGCT
GCGCTGCTCGGCTTTCCTGTGCCCAAGAACAATCTCGGTGCATTCATACCTGAATTTCTGCCATTCTGGCCCGAT
TCCAGTGACAAGGTTCAAATTCTCATCCGCAACGCCAGACAGATCCTTGGAATTGTAACAGCTGCCTTTGGGGCC
GACCTGTTTGACACTCACAGTGACATCGACCCGTGTAACCTGGAGACCACCGATATCAACGAGCTTGCTTGCCAA
TGGCGCAATATCAGCAAACAGGCATCTTCTTTGAAGTCTGCCGCCGAAATCGACTCTGCGTGGCTGTCGGAGATG
TCGGCTTGGTTGCGCAGGGCTCAAGAACTGATGAGCAGCATGGCTTCCAACTACAACATGAGCCGACTGTTCATC
GGCCAGGGCCTGGCCATTGCGGCTGCCCTCTGTAGCGGCGCGGCTGCGATGCTGCAAGACATGCAGCGTAGTGGA
AACTTCATGACTCTGCTGCTGGTGACTCTGTCATACGGCGTCATGATGTTTGCCAGCAGCTACGTAGAGGAGGAA
CAGCACTTCTGGTACTGGTCATCGACAGCTTGGACAGCCTGGCTCGGCTCTCGCGCCATTCGCAGGATGGGACGC
CTGTCGTCCGCTGCTCGGCACACGATTTCGCTCGCCTGCCTACGCCTCGCAAGGAGCTGGAACCAGACGGGCCAG
AAGTTCGCGGGCGAGCCCGACATCGTCAAGCTGTACCTCGCTCCCAACCCGCAGCTCACCTGGTTACTGGCCAGC
CTGCCGTACATACTGGTCGGCCAGCTGCTCCTCGATCTCCCCGGACTCCCCAAACCCGTCTCGGCCTCCCTAGCG
TGCGCACTCGTTTCCGCAGCCTTTACGTTCAAGCTAGCTTTCACTGCCGAGGATGCGCCCGAGCTTGTGTTGGGT
CTCACAAAGAAGCTGAACGACGCCTTGAAAGGTCCATCTCTGATATCAAGAGCGCGAGTCGTCTTTCTGCTGCTC
GCGGCGCTTGCGCTGTTTGCGCTGTACCAGGGGAGAAGAGGTGGAGGCCGATCAAGATCGTCAGTCCGGCTCCTC
CATCACCTCTACACGTTATTCGCGATGACGCAGTCTCGGGCGACCAACATGCCCTTGTTTCTCCTGGCCTCCGTT
GCCTTCCGCAGTCTCGAGCTCGACGGCCTTTCCGTCGTCGACATCACCATCTCGTCTCTCCTCCTCCAGCACACG
TTCTTCTTCGCCTTTGGCGGCTCCAACGCTATCTCCTCCATCGACCTGTCGAGCGCGTACAACGGCGTCAGCGAC
TTCAACATCGCGGCCGTCGGCTTCCTCGCCTTCGTCAGCAACTGGGCCGGGCCCATCTTCTGGACATCGGCCACC
AACCTGCTGCTCCTGCAGAACGACCGCAGGGGCCAGCCGCACGTCTACCGCCGCCACCTCACTCTCCTCACCCTG
TTCGTGACGGCCAGCACGGCGTTCGTCATGGCGGCCTGCACCGCACTGAGGACCCATCTGTTCATCTGGACCGTC
TTCTCGCCCAAGTACCTCTACAGCCTGGCCTGGAGTCTCGTACAGCACTTGGGCGTCAACGTGCTGCTCGGAGGG
CTTCTGTTCCGGTACGGCGCGAGGTAG
Gene >Hirsu2|6847
ATGGTGGTCATAGAGAAGGGGTCATTCCTGTGCACCCTCCTGCTGGCCGTCGCCAACCTGCTCATCCCGCTGTCC
GTCGTCATCTTTGCCACCGGCTTCTTCCCTCACAAGCCTACCCTTCCAGGCTTGGCAGAATATGAGGCTCTCGAG
TTTGGCGCGGTGCCACGCGCCCCCTTTGATCGCCTCGTCTTCATGGTGGTCGACGCGTTGAGAAGGCAAGTACCC
GGCTGACGCTTGGCTCTGGACATATGCTAACGACATTGCAGCGATTTCGTCTACTCAGAGAACTCCGGCTTCCAG
TACACACAGAGGTTTGCCATTCCGTTGCGGTCCCGCTCGACGCTTTCTCTCACATCACGCCCCCAGTCTCATCCG
TGAAGGCACCGCCATGCCCTTCACTGCCAATGCTCGAGCCCCAACTGTGACCATGCCGAGGATCAAGGCCATCAC
CACCGGATCCATCCCTTCATTCGTTGATCTTATACTGAACCTCGATGAGTCTGACACTTCGTCGTCACTGGCAGC
TCAGGACACTTGGCTGGCCCAGCTCAAAGCCAGGGCCAAAGGAAAGCTGCTCATGTACGGTGACGATACCTGGCT
CAAGCTGTTTCCGGATACCTTTGATCGGCACGATGGGACTTCAAGCTTTTTCGTCTCCGTGGGGACTGCCCTTCT
GCGCCTTCCACTCCGACATGGAGCTGATTCTCGTCCAGGACTTCACCGAGGTAGACAACAATGTCACAAGAAACA
TCGCTGCTGAACTCGATAATCAAGATTGGTCTCTCATGGTGCTACACTACCTCGGACTCGATCACATCGGCCACA
AAGCGGGCCCTAGGAGGTACTACCATCAGCCACCCAAGGGGGGGGGGATGCGACTAACGGAAGGCAGCTCCAACA
TGCTCCCCAAGCAGCGCGAAATGGATGGCATTGTCCAGACAATCTACCAGGCGATGGAGTCCAAACATCACCTGG
GATCGACCTTGTTTGTTGTGTGCGGCGATCACGGCATGAATGATGCGGGAAACCACGGAGCGTCGTCTGCTGGCG
AGACGTCGCCAGCCCTTCTCTTCATGTCTCCCAAGCTGAAGAGCATAGCAGCGAGTCTCCCTGCTCCGGCTCAGC
CAAAGGACGAGTTTGACTACTACGCCACTGTCGAACAGTCCGACATTGCTCCGACCATTGCTGCGCTGCTCGGCT
TTCCTGTGCCCAAGAACAATCTCGGTGCATTCATACCTGAATTTCTGCCATTCTGGCCCGATTCCAGTGACAAGG
TTCAAATTCTCATCCGCAACGCCAGACAGATCCTTGGAATTGTAACAGCTGCCTTTGGGGCCGACCTGTTTGACA
CTCACAGTGACATCGACCCGTGTAACCTGGAGACCACCGATATCAACGAGCTTGCTTGCCAATGGCGCAATATCA
GCAAACAGGCATCTTCTTTGAAGTCTGCCGCCGAAATCGACTCTGCGTGGCTGTCGGAGATGTCGGCTTGGTTGC
GCAGGGCTCAAGAACTGATGAGCAGCATGGCTTCCAACTACAACATGAGCCGACTGTTCATCGGCCAGGGCCTGG
CCATTGCGGCTGCCCTCTGTAGCGGCGCGGCTGCGATGCTGCAAGACATGCAGCGTAGTGGAAACTTCATGACTC
TGCTGCTGGTGACTCTGTCATACGGCGTCATGATGTTTGCCAGCAGCTACGTAGAGGAGGAACAGCACTTCTGGT
ACTGGTCATCGACAGCTTGGACAGCCTGGCTCGGCTCTCGCGCCATTCGCAGGTGCGCAGTCCGGCCTCGGCTCC
CTCATCTCGAACGGAAGCTGACCGGGATCCAGGATGGGACGCCTGTCGTCCGCTGCTCGGCACACGATTTCGCTC
GCCTGCCTACGCCTCGCAAGGAGCTGGAACCAGACGGGCCAGAAGTTCGCGGGCGAGCCCGACATCGTCAAGCTG
TACCTCGCTCCCAACCCGCAGCTCACCTGGTTACTGGCCAGCCTGCCGTACATACTGGTCGGCCAGCTGCTCCTC
GATCTCCCCGGACTCCCCAAACCCGTCTCGGCCTCCCTAGCGTGCGCACTCGTTTCCGCAGCCTTTACGTTCAAG
CTAGCTTTCACTGCCGAGGATGCGCCCGAGCTTGTGTTGGGTCTCACAAAGAAGCTGAACGACGCCTTGAAAGGT
CCATCTCTGATATCAAGAGCGCGAGTCGTCTTTCTGCTGCTCGCGGCGCTTGCGCTGTTTGCGCTGTACCAGGGG
AGAAGAGGTGGAGGCCGATCAAGATCGTCAGGTACATTACTTCTCCATCCAACTGCAGTGAAGCTTCATCCCCTC
CTCCCTTCACTTAGTCCCGCCTGTGTAGCTGACCGGAGGTTTCAGTCCGGCTCCTCCATCACCTCTACACGTTAT
TCGCGATGACGCAGTCTCGGGCGACCAACATGCCCTTGTTTCTCCTGGCCTCCGTTGCCTTCCGCAGTCTCGAGC
TCGACGGCCTTTCCGTCGTCGACATCACCATCTCGTCTCTCCTCCTCCAGCACACGTTCTTCTTCGCCTTTGGCG
GCTCCAACGCTATCTCCTCCATCGACCTGTCGAGCGCGTACAACGGCGTCAGCGACTTCAACATCGCGGCCGTCG
GCTTCCTCGCCTTCGTCAGCAACTGGGCCGGGCCCATCTTCTGGACATCGGCCACCAACCTGCTGCTCCTGCAGA
ACGACCGCAGGGGCCAGCCGCACGTCTACCGCCGCCACCTCACTCTCCTCACCCTGTTCGTGACGGCCAGCACGG
CGTTCGTCATGGCGGCCTGCACCGCACTGAGGACCCATCTGTTCATCTGGACCGTCTTCTCGCCCAAGTACCTCT
ACAGCCTGGCCTGGAGTCTCGTACAGCACTTGGGCGTCAACGTGCTGCTCGGAGGGCTTCTGTTCCGGTACGGCG
CGAGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail