Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6843
Gene name
LocationContig_37:4153..6424
Strand-
Gene length (bp)2271
Transcript length (bp)2175
Coding sequence length (bp)2175
Protein length (aa) 725

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05653 Mg_trans_NIPA Magnesium transporter NIPA 9.7E-57 149 399

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GYS1|NIPA7_ARATH Probable magnesium transporter NIPA7 OS=Arabidopsis thaliana GN=At4g38730 PE=2 SV=1 113 403 3.0E-39
sp|Q9LNK7|NIPA3_ARATH Probable magnesium transporter NIPA3 OS=Arabidopsis thaliana GN=At1g34470 PE=2 SV=1 118 433 2.0E-37
sp|Q94AH3|NIPA4_ARATH Probable magnesium transporter NIPA4 OS=Arabidopsis thaliana GN=At1g71900 PE=2 SV=1 118 431 7.0E-37
sp|Q9H841|NPAL2_HUMAN NIPA-like protein 2 OS=Homo sapiens GN=NIPAL2 PE=2 SV=1 155 419 5.0E-35
sp|F4JKQ7|NIPA5_ARATH Probable magnesium transporter NIPA5 OS=Arabidopsis thaliana GN=At4g09640 PE=2 SV=1 154 414 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GYS1|NIPA7_ARATH Probable magnesium transporter NIPA7 OS=Arabidopsis thaliana GN=At4g38730 PE=2 SV=1 113 403 3.0E-39
sp|Q9LNK7|NIPA3_ARATH Probable magnesium transporter NIPA3 OS=Arabidopsis thaliana GN=At1g34470 PE=2 SV=1 118 433 2.0E-37
sp|Q94AH3|NIPA4_ARATH Probable magnesium transporter NIPA4 OS=Arabidopsis thaliana GN=At1g71900 PE=2 SV=1 118 431 7.0E-37
sp|Q9H841|NPAL2_HUMAN NIPA-like protein 2 OS=Homo sapiens GN=NIPAL2 PE=2 SV=1 155 419 5.0E-35
sp|F4JKQ7|NIPA5_ARATH Probable magnesium transporter NIPA5 OS=Arabidopsis thaliana GN=At4g09640 PE=2 SV=1 154 414 1.0E-34
sp|Q8GWX2|NIPA6_ARATH Probable magnesium transporter NIPA6 OS=Arabidopsis thaliana GN=At2g21120 PE=2 SV=1 113 405 6.0E-34
sp|Q91WC7|NPAL2_MOUSE NIPA-like protein 2 OS=Mus musculus GN=Nipal2 PE=2 SV=1 155 406 3.0E-32
sp|B3LFA3|NIPA2_ARATH Probable magnesium transporter NIPA2 OS=Arabidopsis thaliana GN=At4g13800 PE=2 SV=1 155 395 2.0E-31
sp|Q9LIR9|NIPA1_ARATH Probable magnesium transporter NIPA1 OS=Arabidopsis thaliana GN=At3g23870 PE=2 SV=1 155 395 1.0E-30
sp|Q6P499|NPAL3_HUMAN NIPA-like protein 3 OS=Homo sapiens GN=NIPAL3 PE=1 SV=1 155 401 7.0E-30
sp|Q5RD30|NPAL3_PONAB NIPA-like protein 3 OS=Pongo abelii GN=NIPAL3 PE=2 SV=1 155 401 1.0E-29
sp|Q8BZF2|NIPA4_MOUSE Magnesium transporter NIPA4 OS=Mus musculus GN=Nipal4 PE=1 SV=1 155 405 3.0E-29
sp|Q3SWX0|NIPA2_BOVIN Magnesium transporter NIPA2 OS=Bos taurus GN=NIPA2 PE=2 SV=1 155 449 1.0E-27
sp|Q5R7Q3|NIPA2_PONAB Magnesium transporter NIPA2 OS=Pongo abelii GN=NIPA2 PE=2 SV=1 155 448 3.0E-27
sp|Q8N8Q9|NIPA2_HUMAN Magnesium transporter NIPA2 OS=Homo sapiens GN=NIPA2 PE=2 SV=1 155 448 3.0E-27
sp|Q0D2K0|NIPA4_HUMAN Magnesium transporter NIPA4 OS=Homo sapiens GN=NIPAL4 PE=1 SV=3 155 395 6.0E-27
sp|Q9JJC8|NIPA2_MOUSE Magnesium transporter NIPA2 OS=Mus musculus GN=Nipa2 PE=1 SV=1 155 395 2.0E-26
sp|Q8BGN5|NPAL3_MOUSE NIPA-like protein 3 OS=Mus musculus GN=Nipal3 PE=2 SV=1 155 401 7.0E-24
sp|Q7RTP0|NIPA1_HUMAN Magnesium transporter NIPA1 OS=Homo sapiens GN=NIPA1 PE=1 SV=1 153 373 1.0E-20
sp|Q8BHK1|NIPA1_MOUSE Magnesium transporter NIPA1 OS=Mus musculus GN=Nipa1 PE=1 SV=1 153 373 3.0E-20
sp|Q8BMW7|NIPA3_MOUSE Magnesium transporter NIPA3 OS=Mus musculus GN=Nipal1 PE=1 SV=2 118 402 6.0E-20
sp|Q5RDB8|NIPA3_PONAB Magnesium transporter NIPA3 OS=Pongo abelii GN=NIPAL1 PE=2 SV=1 154 400 4.0E-18
sp|Q6NVV3|NIPA3_HUMAN Magnesium transporter NIPA3 OS=Homo sapiens GN=NIPAL1 PE=2 SV=1 154 400 1.0E-17
sp|Q8RWF4|NIPA8_ARATH Probable magnesium transporter NIPA8 OS=Arabidopsis thaliana GN=At3g26670 PE=2 SV=1 161 404 4.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0015693 magnesium ion transport Yes
GO:0016021 integral component of membrane Yes
GO:0015095 magnesium ion transmembrane transporter activity Yes
GO:0008324 cation transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0046873 metal ion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0072511 divalent inorganic cation transport No
GO:0006812 cation transport No
GO:0070838 divalent metal ion transport No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0030001 metal ion transport No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 160 182 22
3 186 208 22
4 215 232 17
5 247 269 22
6 308 330 22
7 345 367 22
8 379 396 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6843
MQTPSSPPMMTTTIAPSAPTATGVPDSPGKALQNWSSLIGIITAIVGNVLIALALNVQRYAHTRLHKERVRVRQR
ARAVGKRAQHGSSNGSSNSNNGHSGPYGALGGEANGRDEDDGVLPMAGSYHSGAAADGEVRGVDDEDDDDDEQGK
VASTYLKSPYWWLGQILITLGEMGNFLAYGFAPASIVSPLGVVALVSNCIIAPVMFHEKFRARDFWGVVIAVSGV
VTVVLSANQQETKLGPHEVWEAITTTEFEIYMAVTTLLILILMWASGRYGKRTILIDLGLVGLFGGYTALATKGV
SSMLSSTLWRAFATPVTYVLMLILLVTAVMQIRYVNKALQRFDSTQVIPIQFVLFTLCVILGSAILYRDFEKTTA
EQAVKFVGGCLLTFFGVFLITSGRQQQEDEDEEALSDAEGVEETIGLMQQEGGHGPEPSSAPGPQSRRSSRLSRV
SFAETIKAGPSADEPDMPWLRLPGASESSPDVLGAEPSSLHSNPWRESWDGGLPTPAAPAPAPAAGGGARTLSAD
AATMVSGAAASTSMHSFPATPTRDSPASQSLHPYADGPRSHGSTSRPSLGHRRSKTFISPSPLSSTVTTVVKDAF
LGGHDRSVGQRSSLKRIRSSIRASLFFQDEQDRGIAAAAAAGRGQVAALVSEDYLPRMARVRTAEGRPGGASEEA
GRGRSRSVSGALGELFRPRKKKKKWTGTGDGAGSAGSEAEAGSYGTGTG*
Coding >Hirsu2|6843
ATGCAGACTCCGTCCTCGCCGCCGATGATGACGACGACGATCGCTCCGTCGGCGCCGACGGCGACCGGCGTTCCC
GACAGCCCCGGCAAGGCCCTGCAGAACTGGTCGTCCCTGATCGGCATCATCACGGCCATCGTCGGCAACGTGCTT
ATCGCGCTGGCGCTCAACGTACAGAGGTACGCGCACACGCGGCTGCACAAGGAACGGGTGCGTGTGCGCCAGCGG
GCGCGTGCGGTGGGCAAGCGGGCACAGCACGGCAGCAGCAACGGCAGCAGCAACAGCAACAACGGCCATTCGGGC
CCCTATGGCGCCCTCGGCGGCGAGGCCAACGGGCGAGACGAAGATGACGGCGTCCTTCCGATGGCGGGCTCGTAC
CATTCCGGCGCGGCCGCGGACGGCGAGGTCCGCGGAGTCGACGACGAGGACGATGACGACGACGAGCAGGGCAAG
GTAGCCTCGACCTATCTCAAGTCGCCGTACTGGTGGCTCGGGCAGATCCTCATCACGCTCGGCGAGATGGGCAAC
TTCCTGGCCTACGGCTTCGCGCCGGCGTCCATCGTATCGCCGCTGGGCGTCGTCGCGCTCGTGTCCAACTGCATC
ATCGCCCCCGTCATGTTCCACGAGAAGTTCCGGGCGAGGGACTTTTGGGGTGTGGTCATCGCCGTCTCGGGCGTC
GTGACCGTCGTCCTCAGCGCCAACCAGCAGGAGACAAAGCTGGGGCCGCACGAGGTGTGGGAGGCAATCACGACG
ACCGAGTTTGAAATCTACATGGCCGTGACGACCTTGCTCATCCTGATCCTGATGTGGGCGAGCGGGCGGTACGGC
AAACGAACGATACTCATCGACCTCGGTCTCGTCGGTCTATTTGGTGGCTACACGGCGCTGGCGACCAAGGGCGTG
TCGTCGATGCTGTCGTCGACGCTGTGGAGGGCATTCGCGACGCCGGTGACGTACGTGCTGATGCTCATCCTACTG
GTGACGGCGGTGATGCAGATTCGCTACGTCAACAAGGCACTGCAGCGGTTCGACTCGACGCAGGTGATACCGATC
CAGTTCGTCCTCTTCACCCTCTGCGTCATCCTGGGAAGCGCGATCCTGTACCGCGACTTCGAGAAGACAACGGCG
GAGCAGGCGGTCAAGTTTGTCGGCGGCTGCCTGCTCACCTTCTTCGGCGTCTTCCTCATCACTAGCGGGCGACAG
CAGCAGGAGGACGAGGACGAGGAGGCGCTGTCGGACGCGGAAGGGGTCGAGGAGACGATCGGGCTGATGCAGCAA
GAGGGAGGCCACGGGCCGGAGCCGAGCTCGGCGCCCGGGCCGCAGTCGCGACGATCCAGTCGGCTGTCGCGGGTC
AGCTTCGCGGAGACGATCAAGGCGGGGCCGTCGGCGGACGAGCCAGACATGCCGTGGCTCCGGCTGCCGGGGGCG
TCGGAGAGCTCGCCGGACGTGCTGGGGGCGGAGCCGTCGTCGCTGCACAGCAACCCGTGGCGAGAATCCTGGGAC
GGCGGGCTGCCAACACCGGCAGCACCGGCGCCAGCACCGGCGGCGGGCGGCGGAGCGCGGACGCTGTCTGCGGAC
GCGGCGACGATGGTGTCGGGCGCGGCGGCGTCGACGTCGATGCACTCGTTCCCGGCGACGCCGACCCGGGACTCG
CCGGCGTCGCAGTCGCTCCACCCGTACGCGGACGGCCCGCGGAGCCACGGGAGCACGTCGCGGCCGTCGCTGGGC
CACCGGCGGTCCAAGACGTTCATCTCGCCGTCGCCGCTGTCGTCGACGGTGACGACGGTGGTCAAGGACGCGTTC
CTGGGGGGGCACGACCGGTCGGTGGGCCAGAGATCGTCGCTGAAGCGGATCCGGTCCAGCATACGGGCCAGCCTG
TTCTTCCAAGACGAGCAGGACCGGGGCATTGCGGCGGCGGCGGCGGCGGGGCGAGGCCAGGTGGCGGCTCTGGTA
TCGGAGGACTACCTGCCGCGGATGGCGAGGGTACGGACGGCGGAGGGGCGGCCGGGCGGGGCGTCGGAGGAGGCG
GGCCGGGGGCGGTCACGGAGCGTCAGCGGGGCGCTGGGCGAGCTGTTCCGGCCGCGGAAGAAGAAGAAGAAGTGG
ACGGGGACGGGGGACGGGGCGGGCTCGGCGGGGAGCGAGGCCGAGGCAGGCAGCTACGGGACGGGGACGGGCTGA
Transcript >Hirsu2|6843
ATGCAGACTCCGTCCTCGCCGCCGATGATGACGACGACGATCGCTCCGTCGGCGCCGACGGCGACCGGCGTTCCC
GACAGCCCCGGCAAGGCCCTGCAGAACTGGTCGTCCCTGATCGGCATCATCACGGCCATCGTCGGCAACGTGCTT
ATCGCGCTGGCGCTCAACGTACAGAGGTACGCGCACACGCGGCTGCACAAGGAACGGGTGCGTGTGCGCCAGCGG
GCGCGTGCGGTGGGCAAGCGGGCACAGCACGGCAGCAGCAACGGCAGCAGCAACAGCAACAACGGCCATTCGGGC
CCCTATGGCGCCCTCGGCGGCGAGGCCAACGGGCGAGACGAAGATGACGGCGTCCTTCCGATGGCGGGCTCGTAC
CATTCCGGCGCGGCCGCGGACGGCGAGGTCCGCGGAGTCGACGACGAGGACGATGACGACGACGAGCAGGGCAAG
GTAGCCTCGACCTATCTCAAGTCGCCGTACTGGTGGCTCGGGCAGATCCTCATCACGCTCGGCGAGATGGGCAAC
TTCCTGGCCTACGGCTTCGCGCCGGCGTCCATCGTATCGCCGCTGGGCGTCGTCGCGCTCGTGTCCAACTGCATC
ATCGCCCCCGTCATGTTCCACGAGAAGTTCCGGGCGAGGGACTTTTGGGGTGTGGTCATCGCCGTCTCGGGCGTC
GTGACCGTCGTCCTCAGCGCCAACCAGCAGGAGACAAAGCTGGGGCCGCACGAGGTGTGGGAGGCAATCACGACG
ACCGAGTTTGAAATCTACATGGCCGTGACGACCTTGCTCATCCTGATCCTGATGTGGGCGAGCGGGCGGTACGGC
AAACGAACGATACTCATCGACCTCGGTCTCGTCGGTCTATTTGGTGGCTACACGGCGCTGGCGACCAAGGGCGTG
TCGTCGATGCTGTCGTCGACGCTGTGGAGGGCATTCGCGACGCCGGTGACGTACGTGCTGATGCTCATCCTACTG
GTGACGGCGGTGATGCAGATTCGCTACGTCAACAAGGCACTGCAGCGGTTCGACTCGACGCAGGTGATACCGATC
CAGTTCGTCCTCTTCACCCTCTGCGTCATCCTGGGAAGCGCGATCCTGTACCGCGACTTCGAGAAGACAACGGCG
GAGCAGGCGGTCAAGTTTGTCGGCGGCTGCCTGCTCACCTTCTTCGGCGTCTTCCTCATCACTAGCGGGCGACAG
CAGCAGGAGGACGAGGACGAGGAGGCGCTGTCGGACGCGGAAGGGGTCGAGGAGACGATCGGGCTGATGCAGCAA
GAGGGAGGCCACGGGCCGGAGCCGAGCTCGGCGCCCGGGCCGCAGTCGCGACGATCCAGTCGGCTGTCGCGGGTC
AGCTTCGCGGAGACGATCAAGGCGGGGCCGTCGGCGGACGAGCCAGACATGCCGTGGCTCCGGCTGCCGGGGGCG
TCGGAGAGCTCGCCGGACGTGCTGGGGGCGGAGCCGTCGTCGCTGCACAGCAACCCGTGGCGAGAATCCTGGGAC
GGCGGGCTGCCAACACCGGCAGCACCGGCGCCAGCACCGGCGGCGGGCGGCGGAGCGCGGACGCTGTCTGCGGAC
GCGGCGACGATGGTGTCGGGCGCGGCGGCGTCGACGTCGATGCACTCGTTCCCGGCGACGCCGACCCGGGACTCG
CCGGCGTCGCAGTCGCTCCACCCGTACGCGGACGGCCCGCGGAGCCACGGGAGCACGTCGCGGCCGTCGCTGGGC
CACCGGCGGTCCAAGACGTTCATCTCGCCGTCGCCGCTGTCGTCGACGGTGACGACGGTGGTCAAGGACGCGTTC
CTGGGGGGGCACGACCGGTCGGTGGGCCAGAGATCGTCGCTGAAGCGGATCCGGTCCAGCATACGGGCCAGCCTG
TTCTTCCAAGACGAGCAGGACCGGGGCATTGCGGCGGCGGCGGCGGCGGGGCGAGGCCAGGTGGCGGCTCTGGTA
TCGGAGGACTACCTGCCGCGGATGGCGAGGGTACGGACGGCGGAGGGGCGGCCGGGCGGGGCGTCGGAGGAGGCG
GGCCGGGGGCGGTCACGGAGCGTCAGCGGGGCGCTGGGCGAGCTGTTCCGGCCGCGGAAGAAGAAGAAGAAGTGG
ACGGGGACGGGGGACGGGGCGGGCTCGGCGGGGAGCGAGGCCGAGGCAGGCAGCTACGGGACGGGGACGGGCTGA
Gene >Hirsu2|6843
ATGCAGACTCCGTCCTCGCCGCCGATGATGACGACGACGATCGCTCCGTCGGCGCCGACGGCGACCGGCGTTCCC
GACAGCCCCGGCAAGGCCCTGCAGAACTGGTCGTCCCTGATCGGCATCATCACGGCCATCGTCGGCAACGTGCTT
ATCGCGCTGGCGCTCAACGTACAGAGGTACGCGCACACGCGGCTGCACAAGGAACGGGTGCGTGTGCGCCAGCGG
GCGCGTGCGGTGGGCAAGCGGGCACAGCACGGCAGCAGCAACGGCAGCAGCAACAGCAACAACGGCCATTCGGGC
CCCTATGGCGCCCTCGGCGGCGAGGCCAACGGGCGAGACGAAGATGACGGCGTCCTTCCGATGGCGGGCTCGTAC
CATTCCGGCGCGGCCGCGGACGGCGAGGTCCGCGGAGTCGACGACGAGGACGATGACGACGACGAGCAGGGCAAG
GTAGCCTCGACCTATCTCAAGTCGCCGTACTGGTGGCTCGGGCAGATCCTCATCACGCTCGGCGAGATGGGCAAC
TTCCTGGCCTACGGCTTCGCGCCGGCGTCCATCGTATCGCCGCTGGGCGTCGTCGCGCTCGTGTCCAACTGCATC
ATCGCCCCCGTCATGTTCCACGAGAAGTTCCGGGCGAGGGACTTTTGGGGTGTGGTCATCGCCGTCTCGGGCGTC
GTGACCGTCGTCCTCAGCGCCAACCAGCAGGAGACAAAGCTGGGGCCGCACGAGGTGTGGGAGGCAATCACGACG
ACCGAGTTTGAAATCTACATGGCCGTGACGACCTTGCTCATCCTGATCCTGATGTGGGCGAGCGGGCGGTACGGC
AAACGAACGATACTCATCGACCTCGGTCTCGTCGGTCTATTTGGTATGTCCAATCCCCGCCCTCAACATTTACTC
GTGGGCGTGCGTGTGTGTTTGTGTGTGTATGAGAGTGTTCCTAACTTGATGACGTCATGGTTAGGTGGCTACACG
GCGCTGGCGACCAAGGGCGTGTCGTCGATGCTGTCGTCGACGCTGTGGAGGGCATTCGCGACGCCGGTGACGTAC
GTGCTGATGCTCATCCTACTGGTGACGGCGGTGATGCAGATTCGCTACGTCAACAAGGCACTGCAGCGGTTCGAC
TCGACGCAGGTGATACCGATCCAGTTCGTCCTCTTCACCCTCTGCGTCATCCTGGGAAGCGCGATCCTGTACCGC
GACTTCGAGAAGACAACGGCGGAGCAGGCGGTCAAGTTTGTCGGCGGCTGCCTGCTCACCTTCTTCGGCGTCTTC
CTCATCACTAGCGGGCGACAGCAGCAGGAGGACGAGGACGAGGAGGCGCTGTCGGACGCGGAAGGGGTCGAGGAG
ACGATCGGGCTGATGCAGCAAGAGGGAGGCCACGGGCCGGAGCCGAGCTCGGCGCCCGGGCCGCAGTCGCGACGA
TCCAGTCGGCTGTCGCGGGTCAGCTTCGCGGAGACGATCAAGGCGGGGCCGTCGGCGGACGAGCCAGACATGCCG
TGGCTCCGGCTGCCGGGGGCGTCGGAGAGCTCGCCGGACGTGCTGGGGGCGGAGCCGTCGTCGCTGCACAGCAAC
CCGTGGCGAGAATCCTGGGACGGCGGGCTGCCAACACCGGCAGCACCGGCGCCAGCACCGGCGGCGGGCGGCGGA
GCGCGGACGCTGTCTGCGGACGCGGCGACGATGGTGTCGGGCGCGGCGGCGTCGACGTCGATGCACTCGTTCCCG
GCGACGCCGACCCGGGACTCGCCGGCGTCGCAGTCGCTCCACCCGTACGCGGACGGCCCGCGGAGCCACGGGAGC
ACGTCGCGGCCGTCGCTGGGCCACCGGCGGTCCAAGACGTTCATCTCGCCGTCGCCGCTGTCGTCGACGGTGACG
ACGGTGGTCAAGGACGCGTTCCTGGGGGGGCACGACCGGTCGGTGGGCCAGAGATCGTCGCTGAAGCGGATCCGG
TCCAGCATACGGGCCAGCCTGTTCTTCCAAGACGAGCAGGACCGGGGCATTGCGGCGGCGGCGGCGGCGGGGCGA
GGCCAGGTGGCGGCTCTGGTATCGGAGGACTACCTGCCGCGGATGGCGAGGGTACGGACGGCGGAGGGGCGGCCG
GGCGGGGCGTCGGAGGAGGCGGGCCGGGGGCGGTCACGGAGCGTCAGCGGGGCGCTGGGCGAGCTGTTCCGGCCG
CGGAAGAAGAAGAAGAAGTGGACGGGGACGGGGGACGGGGCGGGCTCGGCGGGGAGCGAGGCCGAGGCAGGCAGC
TACGGGACGGGGACGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail