Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6842
Gene name
LocationContig_369:20361..20713
Strand+
Gene length (bp)352
Transcript length (bp)213
Coding sequence length (bp)213
Protein length (aa) 71

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11022 ATP19 ATP synthase subunit K 9.6E-26 4 70

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C6Y4A3|ATP19_SCHPO ATP synthase subunit K, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp19 PE=2 SV=1 4 68 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6842
MAGVSSYTILGRQVGSHQIAMAWLGTLTGAIYWAASGPKKSADQATPPINASSSAEADFIKKFMEEQEKK*
Coding >Hirsu2|6842
ATGGCTGGCGTCTCCTCCTATACCATTCTTGGCCGGCAGGTCGGCAGCCACCAGATTGCCATGGCATGGCTGGGA
ACCCTGACCGGCGCCATCTACTGGGCCGCGTCCGGCCCCAAGAAGAGCGCGGACCAGGCCACGCCCCCGATCAAT
GCCTCGAGCTCGGCCGAGGCCGACTTCATCAAGAAGTTTATGGAGGAGCAGGAGAAGAAATAG
Transcript >Hirsu2|6842
ATGGCTGGCGTCTCCTCCTATACCATTCTTGGCCGGCAGGTCGGCAGCCACCAGATTGCCATGGCATGGCTGGGA
ACCCTGACCGGCGCCATCTACTGGGCCGCGTCCGGCCCCAAGAAGAGCGCGGACCAGGCCACGCCCCCGATCAAT
GCCTCGAGCTCGGCCGAGGCCGACTTCATCAAGAAGTTTATGGAGGAGCAGGAGAAGAAATAG
Gene >Hirsu2|6842
ATGGCTGGCGTCTCCTCCTATACCATTCTTGGCCGGCAGGTCGGCAGCCACCAGGTTCGCATCTTGGCCCCCCCC
CTCCCTTCCCCCTTCAGCTGCGTCGCTGTGACCGTTCTGCGATGATGGATTGACGGCTTCCGGTACAGATTGCCA
TGGCATGGCTGGGAACCCTGACCGGCGCCATCTACTGGGCCGCGTCCGGCCCCAAGAAGAGCGCGGACCAGGCCA
CGCCCCCGATCAATGCCTCGAGCTCGGCCGAGGCCGACTTCATCAAGTGCGTCTTTTCCGCTGCGCAGCCGAACG
CCGAGCTAACACACGCGGCAGGAAGTTTATGGAGGAGCAGGAGAAGAAATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail