Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|684
Gene name
LocationContig_1139:4678..5053
Strand+
Gene length (bp)375
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07896 DUF1674 Protein of unknown function (DUF1674) 7.8E-17 64 124

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38345|SDHF4_YEAST Succinate dehydrogenase assembly factor 4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH8 PE=1 SV=2 23 124 2.0E-20
sp|C6Y4C4|SDHF4_SCHPO Succinate dehydrogenase assembly factor 4, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.16 PE=2 SV=1 22 124 1.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|684
MSRLLSLRRLPHARLSSTFTARPAPPKLPADQQAEFERLQRAAAVSSAFQAPPPTDPARPAKQDPAAAADNDDDD
VNRGLVRGAPPEFKGDVNPKTGEVGGPKNEPLRWGGKGDWSYNGRVTDF*
Coding >Hirsu2|684
ATGTCTCGCCTCCTCTCCCTCCGCCGCCTCCCCCACGCCCGCCTGTCCTCCACCTTCACCGCCCGCCCCGCCCCG
CCCAAGCTCCCCGCCGACCAGCAGGCCGAGTTCGAGCGGCTGCAGCGCGCCGCCGCCGTCTCCTCCGCCTTCCAA
GCCCCCCCGCCCACCGACCCGGCCCGGCCGGCGAAGCAGGACCCCGCCGCCGCCGCCGACAACGACGACGACGAC
GTCAACCGTGGCCTCGTCCGCGGCGCCCCGCCCGAGTTCAAGGGCGACGTCAATCCCAAGACGGGCGAGGTCGGC
GGCCCCAAGAACGAGCCGCTGCGCTGGGGCGGCAAAGGCGACTGGAGCTACAACGGCCGCGTCACCGACTTCTGA
Transcript >Hirsu2|684
ATGTCTCGCCTCCTCTCCCTCCGCCGCCTCCCCCACGCCCGCCTGTCCTCCACCTTCACCGCCCGCCCCGCCCCG
CCCAAGCTCCCCGCCGACCAGCAGGCCGAGTTCGAGCGGCTGCAGCGCGCCGCCGCCGTCTCCTCCGCCTTCCAA
GCCCCCCCGCCCACCGACCCGGCCCGGCCGGCGAAGCAGGACCCCGCCGCCGCCGCCGACAACGACGACGACGAC
GTCAACCGTGGCCTCGTCCGCGGCGCCCCGCCCGAGTTCAAGGGCGACGTCAATCCCAAGACGGGCGAGGTCGGC
GGCCCCAAGAACGAGCCGCTGCGCTGGGGCGGCAAAGGCGACTGGAGCTACAACGGCCGCGTCACCGACTTCTGA
Gene >Hirsu2|684
ATGTCTCGCCTCCTCTCCCTCCGCCGCCTCCCCCACGCCCGCCTGTCCTCCACCTTCACCGCCCGCCCCGCCCCG
CCCAAGCTCCCCGCCGACCAGCAGGCCGAGTTCGAGCGGCTGCAGCGCGCCGCCGCCGTCTCCTCCGCCTTCCAA
GCCCCCCCGCCCACCGACCCGGCCCGGCCGGCGAAGCAGGACCCCGCCGCCGCCGCCGACAACGACGACGACGAC
GTCAACCGTGGCCTCGTCCGCGGCGCCCCGCCCGAGTTCAAGGGCGACGTCAATCCCAAGACGGGCGAGGTCGGC
GGCCCCAAGAACGAGCCGCTGCGCTGGGGCGGCAAAGGCGACTGGAGCTACAACGGCCGCGTCACCGACTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail