Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6834
Gene name
LocationContig_368:17394..19213
Strand-
Gene length (bp)1819
Transcript length (bp)1596
Coding sequence length (bp)1596
Protein length (aa) 532

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 1.4E-59 27 471
PF00324 AA_permease Amino acid permease 6.5E-33 40 479

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 8 490 2.0E-87
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 13 490 3.0E-81
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 2 518 2.0E-78
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 10 499 3.0E-71
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 1 523 1.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 8 490 2.0E-87
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 13 490 3.0E-81
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 2 518 2.0E-78
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 10 499 3.0E-71
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 1 523 1.0E-69
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 10 502 3.0E-64
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 2 490 1.0E-57
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 6 524 1.0E-54
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 2 529 3.0E-49
sp|O74248|GPT1_CANAX Putative polyamine transporter OS=Candida albicans GN=GPT1 PE=3 SV=1 8 531 3.0E-42
sp|Q9C0Z0|YKM2_SCHPO Uncharacterized amino-acid permease PB24D3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.02c PE=3 SV=1 2 497 1.0E-40
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 1 529 1.0E-35
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 1 470 2.0E-35
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 3 469 6.0E-33
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 10 477 4.0E-30
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 8 468 5.0E-28
sp|P0AA47|PLAP_ECOLI Low-affinity putrescine importer PlaP OS=Escherichia coli (strain K12) GN=plaP PE=1 SV=1 19 349 3.0E-10
sp|P0AA48|PLAP_ECO57 Low-affinity putrescine importer PlaP OS=Escherichia coli O157:H7 GN=plaP PE=3 SV=1 19 349 3.0E-10
sp|O34739|STET_BACSU Serine/threonine exchanger SteT OS=Bacillus subtilis (strain 168) GN=steT PE=1 SV=1 55 378 2.0E-06
sp|P06775|HIP1_YEAST Histidine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIP1 PE=1 SV=2 3 360 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22
2 63 85 22
3 92 114 22
4 147 169 22
5 181 203 22
6 223 245 22
7 262 284 22
8 310 332 22
9 365 387 22
10 391 413 22
11 426 448 22
12 463 482 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6834
MDDARRASADQALGQFGYRGELPRNLSMMSILGLSFAIMAVPFGLSTTLSITLTNGQAVSVLYGWLLVSLISVCI
AASLAEICAVFPTAGGVYYWSATLSPPAWAPLVSFVDGWLTLVGNWTVTLSINFSGAQLLLSAVSLFDPDYVAGP
WHTVLAFWAVMLLCALVNAFASRHLDFINKLCIYWTSASVLVILVTLLATARHRRDAAFVFAHYDASASGWPPAW
SFFVGLLQPAYTLTGYGMVASMCEEVQNPEREVPRAIVLSVVAAGVTGIVYILPLLFVLPDVQMLLQVANSQPIG
LLFKTVTGSAGGGLGLLILILGILLFAGIGALTAASRCTYAFARDGAVPGHQLWSRVNRRLDMPLWALGLSTAVD
CVLGCIYFGSSAAFNSFTGVATICLSTSYGVPVLVSLLRGRRHVSRSPFPLGRFGVAINVVCVVWIVFAVVIFCM
PVSLPVSPSSMNYASVVFAGFAAIAFVWYFAYARRNFTGPPVVSVDSLDNGVVDGRSLKEAGSNGAADSEDTPRP
TVSKLE*
Coding >Hirsu2|6834
ATGGACGACGCCCGCCGCGCGTCGGCCGACCAGGCGCTGGGCCAGTTCGGCTACCGGGGCGAGCTGCCGCGCAAC
CTCAGCATGATGAGCATCCTGGGCCTGTCGTTCGCCATCATGGCCGTGCCGTTCGGCCTGTCGACGACGCTGTCC
ATCACGCTGACCAACGGCCAGGCCGTCTCGGTCCTGTACGGCTGGCTTCTCGTCTCGCTCATCTCCGTCTGCATC
GCCGCCTCGCTCGCCGAGATCTGCGCCGTCTTCCCGACCGCCGGCGGCGTCTACTACTGGTCCGCCACGCTGAGC
CCGCCCGCCTGGGCGCCGCTCGTCAGCTTCGTCGACGGCTGGCTCACCCTCGTCGGCAACTGGACCGTCACCCTG
TCCATCAACTTCTCCGGCGCCCAGCTGCTGCTCAGCGCCGTCTCCCTCTTCGACCCGGACTACGTCGCCGGGCCC
TGGCACACCGTCCTCGCCTTCTGGGCCGTCATGCTCCTGTGCGCCCTCGTCAACGCCTTCGCCTCGCGCCACCTC
GACTTCATCAACAAGCTGTGCATCTACTGGACCTCGGCCAGCGTCCTCGTCATCCTCGTCACCCTGCTCGCCACC
GCCCGCCACCGCCGCGACGCCGCCTTCGTCTTCGCCCACTACGACGCCTCGGCCAGCGGCTGGCCGCCCGCCTGG
TCCTTCTTCGTCGGCCTCTTGCAACCCGCCTACACCCTGACCGGCTACGGCATGGTCGCCTCCATGTGCGAAGAG
GTCCAGAACCCCGAGCGCGAGGTGCCCAGGGCCATCGTCCTCTCCGTCGTCGCCGCCGGCGTCACCGGCATCGTC
TACATCCTGCCCCTGCTCTTCGTCCTGCCCGACGTCCAGATGCTGCTCCAGGTCGCCAACTCGCAGCCCATCGGC
CTGCTGTTCAAGACCGTCACCGGCTCCGCCGGTGGCGGCCTCGGCCTCCTCATCCTCATCCTCGGCATCCTCCTC
TTCGCCGGCATCGGCGCCCTGACCGCCGCCTCGCGCTGCACCTACGCCTTCGCCCGCGACGGCGCCGTCCCCGGC
CACCAGCTTTGGAGCCGCGTCAACCGCCGGCTCGACATGCCGCTCTGGGCCCTCGGCCTCTCCACCGCCGTCGAC
TGCGTCCTCGGCTGCATCTACTTCGGCTCCTCCGCCGCCTTCAACTCCTTCACCGGCGTCGCCACCATCTGCCTC
TCCACCTCGTACGGCGTCCCCGTCCTCGTCAGCCTCCTCCGTGGCCGCCGCCACGTCAGCCGCTCGCCCTTCCCG
CTCGGCCGCTTCGGCGTCGCCATCAACGTCGTCTGTGTCGTCTGGATCGTCTTCGCCGTCGTCATCTTCTGCATG
CCCGTCTCCCTGCCCGTCAGCCCGAGCTCCATGAATTACGCCTCCGTCGTCTTCGCCGGCTTCGCCGCCATCGCC
TTCGTCTGGTACTTTGCCTATGCGCGCCGCAACTTCACCGGGCCCCCCGTCGTCAGTGTCGACTCGCTCGACAAC
GGAGTCGTCGACGGGAGATCGCTCAAGGAGGCCGGCAGCAACGGCGCCGCCGATTCGGAGGATACGCCCAGGCCC
ACTGTGTCCAAGCTGGAATAG
Transcript >Hirsu2|6834
ATGGACGACGCCCGCCGCGCGTCGGCCGACCAGGCGCTGGGCCAGTTCGGCTACCGGGGCGAGCTGCCGCGCAAC
CTCAGCATGATGAGCATCCTGGGCCTGTCGTTCGCCATCATGGCCGTGCCGTTCGGCCTGTCGACGACGCTGTCC
ATCACGCTGACCAACGGCCAGGCCGTCTCGGTCCTGTACGGCTGGCTTCTCGTCTCGCTCATCTCCGTCTGCATC
GCCGCCTCGCTCGCCGAGATCTGCGCCGTCTTCCCGACCGCCGGCGGCGTCTACTACTGGTCCGCCACGCTGAGC
CCGCCCGCCTGGGCGCCGCTCGTCAGCTTCGTCGACGGCTGGCTCACCCTCGTCGGCAACTGGACCGTCACCCTG
TCCATCAACTTCTCCGGCGCCCAGCTGCTGCTCAGCGCCGTCTCCCTCTTCGACCCGGACTACGTCGCCGGGCCC
TGGCACACCGTCCTCGCCTTCTGGGCCGTCATGCTCCTGTGCGCCCTCGTCAACGCCTTCGCCTCGCGCCACCTC
GACTTCATCAACAAGCTGTGCATCTACTGGACCTCGGCCAGCGTCCTCGTCATCCTCGTCACCCTGCTCGCCACC
GCCCGCCACCGCCGCGACGCCGCCTTCGTCTTCGCCCACTACGACGCCTCGGCCAGCGGCTGGCCGCCCGCCTGG
TCCTTCTTCGTCGGCCTCTTGCAACCCGCCTACACCCTGACCGGCTACGGCATGGTCGCCTCCATGTGCGAAGAG
GTCCAGAACCCCGAGCGCGAGGTGCCCAGGGCCATCGTCCTCTCCGTCGTCGCCGCCGGCGTCACCGGCATCGTC
TACATCCTGCCCCTGCTCTTCGTCCTGCCCGACGTCCAGATGCTGCTCCAGGTCGCCAACTCGCAGCCCATCGGC
CTGCTGTTCAAGACCGTCACCGGCTCCGCCGGTGGCGGCCTCGGCCTCCTCATCCTCATCCTCGGCATCCTCCTC
TTCGCCGGCATCGGCGCCCTGACCGCCGCCTCGCGCTGCACCTACGCCTTCGCCCGCGACGGCGCCGTCCCCGGC
CACCAGCTTTGGAGCCGCGTCAACCGCCGGCTCGACATGCCGCTCTGGGCCCTCGGCCTCTCCACCGCCGTCGAC
TGCGTCCTCGGCTGCATCTACTTCGGCTCCTCCGCCGCCTTCAACTCCTTCACCGGCGTCGCCACCATCTGCCTC
TCCACCTCGTACGGCGTCCCCGTCCTCGTCAGCCTCCTCCGTGGCCGCCGCCACGTCAGCCGCTCGCCCTTCCCG
CTCGGCCGCTTCGGCGTCGCCATCAACGTCGTCTGTGTCGTCTGGATCGTCTTCGCCGTCGTCATCTTCTGCATG
CCCGTCTCCCTGCCCGTCAGCCCGAGCTCCATGAATTACGCCTCCGTCGTCTTCGCCGGCTTCGCCGCCATCGCC
TTCGTCTGGTACTTTGCCTATGCGCGCCGCAACTTCACCGGGCCCCCCGTCGTCAGTGTCGACTCGCTCGACAAC
GGAGTCGTCGACGGGAGATCGCTCAAGGAGGCCGGCAGCAACGGCGCCGCCGATTCGGAGGATACGCCCAGGCCC
ACTGTGTCCAAGCTGGAATAG
Gene >Hirsu2|6834
ATGGACGACGCCCGCCGCGCGTCGGCCGACCAGGCGCTGGGCCAGTTCGGCTACCGGGGCGAGCTGCCGCGCAAC
CTCAGCATGATGAGCATCCTGGGCCTGTCGTTCGCCATCATGGCCGTGCCGTTCGGCCTGTCGACGACGCTGTCC
ATCACGCTGACCAACGGCCAGGCCGTCTCGGTCCTGTACGGCTGGCTTCTCGTCTCGCTCATCTCCGTCTGCATC
GCCGCCTCGCTCGCCGAGATCTGCGCCGTCTTCCCGACCGCCGGCGGCGTCTACTACTGGTCCGCCACGCTGAGC
CCGCCCGCCTGGGCGCCGCTCGTCAGCTTCGTCGACGGCTGGCTCACCCTCGTCGGCAACTGGACCGTCACCCTG
TCCATCAACTTCTCCGGCGCCCAGCTGCTGCTCAGCGCCGTCTCCCTCTTCGACCCGGACTACGTCGCCGGGCCC
TGGCACACCGTCCTCGCCTTCTGGGCCGTCATGCTCCTGTGCGCCCTCGTCAACGCCTTCGCCTCGCGCCACCTC
GACTTCATCAACAAGCTGTGCATCTACTGGACCTCGGCCAGCGTCCTCGTCATCCTCGTCACCCTGCTCGCCACC
GCCCGCCACCGCCGCGACGCCGCCTTCGTCTTCGCCCACTACGACGCCTCGGCCAGCGGCTGGCCGCCCGCCTGG
TCCTTCTTCGTCGGCCTCTTGCAACGTGAGTTCTGTTGCCCCCCTCCCCTCCTCTGTTGTGCATCCCTCCTCGAC
CATTCTCTCGAGATGGGCCTTGACGAGTCTCGAGAGAGACAGAAAGAAAGGTCTCGAGAGAGATAGAAAGAAAGG
TTTCGAGAGAGACAGAAAAAGAAAGTCTCGCGAGAGACAGAAAGAAAGTCCCCCCTTGTCGCCGACTCGCTGACG
AGAACCGACCTCGCCGTCTCCAGCCGCCTACACCCTGACCGGCTACGGCATGGTCGCCTCCATGTGCGAAGAGGT
CCAGAACCCCGAGCGCGAGGTGCCCAGGGCCATCGTCCTCTCCGTCGTCGCCGCCGGCGTCACCGGCATCGTCTA
CATCCTGCCCCTGCTCTTCGTCCTGCCCGACGTCCAGATGCTGCTCCAGGTCGCCAACTCGCAGCCCATCGGCCT
GCTGTTCAAGACCGTCACCGGCTCCGCCGGTGGCGGCCTCGGCCTCCTCATCCTCATCCTCGGCATCCTCCTCTT
CGCCGGCATCGGCGCCCTGACCGCCGCCTCGCGCTGCACCTACGCCTTCGCCCGCGACGGCGCCGTCCCCGGCCA
CCAGCTTTGGAGCCGCGTCAACCGCCGGCTCGACATGCCGCTCTGGGCCCTCGGCCTCTCCACCGCCGTCGACTG
CGTCCTCGGCTGCATCTACTTCGGCTCCTCCGCCGCCTTCAACTCCTTCACCGGCGTCGCCACCATCTGCCTCTC
CACCTCGTACGGCGTCCCCGTCCTCGTCAGCCTCCTCCGTGGCCGCCGCCACGTCAGCCGCTCGCCCTTCCCGCT
CGGCCGCTTCGGCGTCGCCATCAACGTCGTCTGTGTCGTCTGGATCGTCTTCGCCGTCGTCATCTTCTGCATGCC
CGTCTCCCTGCCCGTCAGCCCGAGCTCCATGAATTACGCCTCCGTCGTCTTCGCCGGCTTCGCCGCCATCGCCTT
CGTCTGGTACTTTGCCTATGCGCGCCGCAACTTCACCGGGCCCCCCGTCGTCAGTGTCGACTCGCTCGACAACGG
AGTCGTCGACGGGAGATCGCTCAAGGAGGCCGGCAGCAACGGCGCCGCCGATTCGGAGGATACGCCCAGGCCCAC
TGTGTCCAAGCTGGAATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail