Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6826
Gene name
LocationContig_367:16343..17997
Strand-
Gene length (bp)1654
Transcript length (bp)1287
Coding sequence length (bp)1287
Protein length (aa) 429

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03381 CDC50 LEM3 (ligand-effect modulator 3) family / CDC50 family 2.4E-97 72 392

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTQ5|MUG89_SCHPO Meiotically up-regulated gene 89 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug89 PE=1 SV=1 28 403 1.0E-123
sp|Q96WW4|IVN1_SCHPO Invasion protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ivn1 PE=3 SV=1 16 407 5.0E-106
sp|P25656|CDC50_YEAST Cell division control protein 50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC50 PE=1 SV=1 21 401 2.0E-96
sp|P53740|YN8S_YEAST Uncharacterized protein YNR048W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR048W PE=1 SV=1 27 418 2.0E-90
sp|P42838|LEM3_YEAST Alkylphosphocholine resistance protein LEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEM3 PE=1 SV=1 4 402 2.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTQ5|MUG89_SCHPO Meiotically up-regulated gene 89 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug89 PE=1 SV=1 28 403 1.0E-123
sp|Q96WW4|IVN1_SCHPO Invasion protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ivn1 PE=3 SV=1 16 407 5.0E-106
sp|P25656|CDC50_YEAST Cell division control protein 50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC50 PE=1 SV=1 21 401 2.0E-96
sp|P53740|YN8S_YEAST Uncharacterized protein YNR048W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR048W PE=1 SV=1 27 418 2.0E-90
sp|P42838|LEM3_YEAST Alkylphosphocholine resistance protein LEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEM3 PE=1 SV=1 4 402 2.0E-85
sp|Q9LTW0|ALIS1_ARATH ALA-interacting subunit 1 OS=Arabidopsis thaliana GN=ALIS1 PE=1 SV=1 26 408 1.0E-63
sp|Q9SLK2|ALIS3_ARATH ALA-interacting subunit 3 OS=Arabidopsis thaliana GN=ALIS3 PE=1 SV=1 26 408 4.0E-62
sp|Q8L8W0|ALIS5_ARATH ALA-interacting subunit 5 OS=Arabidopsis thaliana GN=ALIS5 PE=1 SV=1 26 404 7.0E-62
sp|Q9SA35|ALIS4_ARATH Putative ALA-interacting subunit 4 OS=Arabidopsis thaliana GN=ALIS4 PE=2 SV=2 33 407 3.0E-59
sp|Q3MIR4|CC50B_HUMAN Cell cycle control protein 50B OS=Homo sapiens GN=TMEM30B PE=1 SV=1 24 387 1.0E-56
sp|H2L0H3|CHAT1_CAEEL CDC50 family protein chat-1 OS=Caenorhabditis elegans GN=chat-1 PE=2 SV=1 23 387 4.0E-55
sp|Q5F362|CC50A_CHICK Cell cycle control protein 50A OS=Gallus gallus GN=TMEM30A PE=2 SV=1 28 386 8.0E-55
sp|Q8BHG3|CC50B_MOUSE Cell cycle control protein 50B OS=Mus musculus GN=Tmem30b PE=2 SV=1 24 387 7.0E-54
sp|Q8VEK0|CC50A_MOUSE Cell cycle control protein 50A OS=Mus musculus GN=Tmem30a PE=1 SV=1 28 382 2.0E-49
sp|Q17QL5|CC50A_BOVIN Cell cycle control protein 50A OS=Bos taurus GN=TMEM30A PE=1 SV=1 28 382 4.0E-49
sp|Q5R6C0|CC50A_PONAB Cell cycle control protein 50A OS=Pongo abelii GN=TMEM30A PE=2 SV=1 28 386 5.0E-47
sp|Q9NV96|CC50A_HUMAN Cell cycle control protein 50A OS=Homo sapiens GN=TMEM30A PE=1 SV=1 28 386 2.0E-46
sp|Q67YS6|ALIS2_ARATH Putative ALA-interacting subunit 2 OS=Arabidopsis thaliana GN=ALIS2 PE=2 SV=1 16 402 1.0E-45
sp|Q2T9P5|CC50C_BOVIN Cell cycle control protein 50C OS=Bos taurus GN=TMEM30C PE=2 SV=1 22 392 8.0E-44
sp|Q95JK4|CC50C_MACFA Cell cycle control protein 50C OS=Macaca fascicularis GN=TMEM30C PE=2 SV=1 29 392 5.0E-37
sp|Q6AY41|CC50A_RAT Cell cycle control protein 50A OS=Rattus norvegicus GN=Tmem30a PE=2 SV=1 156 382 2.0E-33
sp|Q9D4D7|CC50C_MOUSE Cell cycle control protein 50C OS=Mus musculus GN=Tmem30c PE=2 SV=2 29 394 6.0E-32
sp|Q6AY41|CC50A_RAT Cell cycle control protein 50A OS=Rattus norvegicus GN=Tmem30a PE=2 SV=1 28 56 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.5

Transmembrane Domains

Domain # Start End Length
1 53 75 22
2 363 385 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6826
MSDSPRGPGHADSIDSHDSSPKQAEKKKSRRPANTAFRQQRLKAWQPILTPKTVLPLFFTIGIIFAPIGGLLLYA
SSRVKEIRLDYSRCRVDAGSELSSMPADRVHTAFKTSNKTVDAQWSVQKGVNVRDNQTGATIPTDRCTLEFNIPE
DMGPPVLFYYRLTNFYQNHRRYVDSFDMNQLKGDNRSYGDVHNSKCTPLYGEDSGGGVMKPYYPCGLIANSMFND
TFTSPELINPPGARGAETRVYNMSVTGIAWDSDKALYGPTKSNFSDVLPPPNWRLRYPDNYTEDMPPPNLKEMEH
FQVWMRTAGLPTFSKLYQRNDTDAMVSGRYRVVINDYFPTLEYHGTKSILITTRTVMGGRNPFLGIAYIAVGGVC
ILLGAIFTATHLIKPRKLGDHTYLSWNNAPAAKPPATASSAVASGRDVRPGET*
Coding >Hirsu2|6826
ATGTCCGACTCGCCGCGAGGCCCCGGCCATGCCGACTCCATCGATTCCCACGACTCGAGCCCCAAGCAGGCCGAG
AAGAAGAAGAGCCGTCGGCCTGCGAATACTGCCTTTCGCCAGCAGCGACTCAAAGCCTGGCAGCCGATTCTGACC
CCCAAGACCGTTCTTCCATTGTTCTTCACGATAGGAATCATCTTCGCGCCCATCGGCGGCCTGCTTCTCTACGCC
AGCTCTCGGGTCAAAGAGATCAGGCTGGACTATAGCAGATGCAGGGTCGATGCCGGCTCGGAGCTGAGCTCGATG
CCGGCCGACAGAGTGCACACGGCCTTCAAGACTTCAAACAAGACCGTCGATGCTCAGTGGTCCGTCCAGAAGGGC
GTCAACGTCAGGGACAACCAGACGGGCGCCACGATACCGACCGATCGTTGCACCCTGGAATTCAACATTCCCGAA
GACATGGGGCCGCCCGTCCTCTTCTACTACCGCCTCACCAACTTCTACCAGAACCACCGCCGATACGTCGACTCC
TTTGACATGAATCAGCTCAAGGGTGATAATCGGTCCTATGGGGACGTCCACAACTCCAAGTGCACTCCGCTCTAC
GGAGAAGACAGCGGCGGCGGGGTTATGAAGCCTTACTACCCATGCGGGCTCATTGCCAATTCCATGTTCAACGAC
ACCTTCACCAGCCCCGAACTGATCAACCCTCCCGGTGCCCGCGGTGCCGAGACCCGCGTCTACAACATGAGCGTC
ACCGGCATCGCCTGGGACAGCGACAAGGCGCTCTACGGCCCGACCAAGTCCAACTTCAGCGACGTGCTCCCGCCG
CCCAACTGGCGCCTGCGCTATCCCGACAACTACACGGAAGACATGCCCCCGCCCAATCTGAAGGAGATGGAGCAC
TTCCAGGTCTGGATGCGCACCGCCGGTCTGCCCACCTTCAGCAAGCTATACCAGCGCAACGACACGGACGCCATG
GTCAGCGGGCGGTACCGCGTCGTCATCAACGACTATTTCCCGACGCTCGAGTACCACGGCACCAAGTCCATCCTC
ATCACCACCCGCACCGTTATGGGCGGTCGCAACCCGTTCCTGGGCATCGCCTACATCGCAGTCGGTGGCGTGTGC
ATCCTCCTCGGCGCCATCTTCACCGCCACGCACCTAATCAAGCCCAGGAAGCTCGGAGACCACACGTACCTGTCG
TGGAACAACGCTCCGGCCGCCAAGCCGCCTGCCACGGCCAGCTCGGCCGTTGCGTCTGGCCGCGACGTCCGTCCC
GGCGAGACCTAG
Transcript >Hirsu2|6826
ATGTCCGACTCGCCGCGAGGCCCCGGCCATGCCGACTCCATCGATTCCCACGACTCGAGCCCCAAGCAGGCCGAG
AAGAAGAAGAGCCGTCGGCCTGCGAATACTGCCTTTCGCCAGCAGCGACTCAAAGCCTGGCAGCCGATTCTGACC
CCCAAGACCGTTCTTCCATTGTTCTTCACGATAGGAATCATCTTCGCGCCCATCGGCGGCCTGCTTCTCTACGCC
AGCTCTCGGGTCAAAGAGATCAGGCTGGACTATAGCAGATGCAGGGTCGATGCCGGCTCGGAGCTGAGCTCGATG
CCGGCCGACAGAGTGCACACGGCCTTCAAGACTTCAAACAAGACCGTCGATGCTCAGTGGTCCGTCCAGAAGGGC
GTCAACGTCAGGGACAACCAGACGGGCGCCACGATACCGACCGATCGTTGCACCCTGGAATTCAACATTCCCGAA
GACATGGGGCCGCCCGTCCTCTTCTACTACCGCCTCACCAACTTCTACCAGAACCACCGCCGATACGTCGACTCC
TTTGACATGAATCAGCTCAAGGGTGATAATCGGTCCTATGGGGACGTCCACAACTCCAAGTGCACTCCGCTCTAC
GGAGAAGACAGCGGCGGCGGGGTTATGAAGCCTTACTACCCATGCGGGCTCATTGCCAATTCCATGTTCAACGAC
ACCTTCACCAGCCCCGAACTGATCAACCCTCCCGGTGCCCGCGGTGCCGAGACCCGCGTCTACAACATGAGCGTC
ACCGGCATCGCCTGGGACAGCGACAAGGCGCTCTACGGCCCGACCAAGTCCAACTTCAGCGACGTGCTCCCGCCG
CCCAACTGGCGCCTGCGCTATCCCGACAACTACACGGAAGACATGCCCCCGCCCAATCTGAAGGAGATGGAGCAC
TTCCAGGTCTGGATGCGCACCGCCGGTCTGCCCACCTTCAGCAAGCTATACCAGCGCAACGACACGGACGCCATG
GTCAGCGGGCGGTACCGCGTCGTCATCAACGACTATTTCCCGACGCTCGAGTACCACGGCACCAAGTCCATCCTC
ATCACCACCCGCACCGTTATGGGCGGTCGCAACCCGTTCCTGGGCATCGCCTACATCGCAGTCGGTGGCGTGTGC
ATCCTCCTCGGCGCCATCTTCACCGCCACGCACCTAATCAAGCCCAGGAAGCTCGGAGACCACACGTACCTGTCG
TGGAACAACGCTCCGGCCGCCAAGCCGCCTGCCACGGCCAGCTCGGCCGTTGCGTCTGGCCGCGACGTCCGTCCC
GGCGAGACCTAG
Gene >Hirsu2|6826
ATGTCCGACTCGCCGCGAGGCCCCGGCCATGCCGACTCCATCGATTCCCACGACTCGAGCCCCAAGCAGGCCGAG
AAGAAGAAGAGCCGTCGGCCTGCGAGTGCGTGCCCGGGCCGCTGCCTGATCCCCTGCCGCGCGCCCGACCTGGCC
GGGCTGACGGTTTCGTCACAGATACTGCCTTTCGCCAGCAGCGACTCAAAGCCTGGCAGTATGTGCCTCATCCTG
TCCCGCCGAGAGCGAGCGCGCCATGGGCAAGCCGGAAGGGAGGGGAACCGTTGTCCCGCTCGACGCTGACCCTTC
CTCAGGCCGATTCTGACCCCCAAGACCGTTCTTCCATTGTTCTTCACGATAGGAATCATCTTCGCGCCCATCGGC
GGCCTGCTTCTCTACGCCAGCTCTCGGGTGCGTCTCGGCCCGAGCGAGGCTTCCCTGTCGCTGCCTTCTAACGGA
TGGACAGGTCAAAGAGATCAGGCTGGACTATAGCAGATGCAGGGTCGATGCCGGCTCGGAGCTGAGCTCGATGCC
GGCCGACAGAGTGCACACGGCCTTCAAGACTTCAAACAAGACCGTCGATGCTCAGTGGTCCGTCCAGAAGGGCGT
CAACGTCAGGGACAACCAGACGGGCGCCACGATACCGACCGATCGTTGCACCCTGGAATTCAACATTCCCGAAGA
CATGGGGCCGCCCGTCCTCTTCTACTACCGCCTCACCAACTTCTACCAGAACCACCGCCGATACGTCGACTCCTT
TGACATGAATCAGCTCAAGGGTGATAATCGGTCCTATGGGGACGTCCACAACTCCAAGTGCACTCCGCTCTACGG
AGAAGACAGCGGCGGCGGGGTTATGAAGCCTTACTACCCATGCGGGCTCATTGCCAATTCCATGTTCAACGACAC
CTTCACCAGCCCCGAACTGATCAACCCTCCCGGTGCCCGCGGTGCCGAGACCCGCGTCTACAACATGAGCGTCAC
CGGCATCGCCTGGGACAGCGACAAGGCGCTCTACGGCCCGACCAAGTCCAACTTCAGCGACGTGCTCCCGCCGCC
CAACTGGCGCCTGCGCTATCCCGACAACTACACGGAAGACATGCCCCCGCCCAATCTGAAGGAGATGGAGCACTT
CCAGGTCTGGATGCGCACCGCCGGTCTGCCCACCTTCAGCAAGCTATACCAGCGCAACGACACGGACGCCATGGT
CAGCGGGCGGTACCGCGTCGTCATCAACGACTGTAGGTGGATGCCGCGTGCCGGGAGAGCTTGTCGTGCACGATC
CTCAGGCTGACGGACCCTCGGCACAGATTTCCCGACGCTCGAGTACCACGGCACCAAGTCCATCCTCATCACCAC
CCGCACCGTTATGGGCGGTCGCAACCCGTTCCTGGGCATCGCCTACATCGCAGTCGGTGGCGTGTGCATCCTCCT
CGGCGCCATCTTCACCGCCACGCACCTAATCAAGCCCAGGTCAGCCGGCCCTCCTTCCGCATCGGACCCTCCCCT
CGTCCGTACCGTCCGATGACCCGACTGACCCTCCAGCAGGAAGCTCGGAGACCACACGTACCTGTCGTGGAACAA
CGCTCCGGCCGCCAAGCCGCCTGCCACGGCCAGCTCGGCCGTTGCGTCTGGCCGCGACGTCCGTCCCGGCGAGAC
CTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail