Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6811
Gene name
LocationContig_365:17161..18447
Strand+
Gene length (bp)1286
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08324 PUL PUL domain 1.0E-65 135 401
PF09070 PFU PFU (PLAA family ubiquitin binding) 2.4E-40 1 102

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94289|LUB1_SCHPO Ubiquitin homeostasis protein lub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lub1 PE=1 SV=2 1 366 2.0E-41
sp|P27612|PLAP_MOUSE Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 1 368 6.0E-41
sp|P54319|PLAP_RAT Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 1 368 3.0E-39
sp|P36037|DOA1_YEAST Protein DOA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA1 PE=1 SV=1 1 366 2.0E-36
sp|Q9Y263|PLAP_HUMAN Phospholipase A-2-activating protein OS=Homo sapiens GN=PLAA PE=1 SV=2 1 368 5.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94289|LUB1_SCHPO Ubiquitin homeostasis protein lub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lub1 PE=1 SV=2 1 366 2.0E-41
sp|P27612|PLAP_MOUSE Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 1 368 6.0E-41
sp|P54319|PLAP_RAT Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 1 368 3.0E-39
sp|P36037|DOA1_YEAST Protein DOA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA1 PE=1 SV=1 1 366 2.0E-36
sp|Q9Y263|PLAP_HUMAN Phospholipase A-2-activating protein OS=Homo sapiens GN=PLAA PE=1 SV=2 1 368 5.0E-36
sp|Q6GM65|PLAP_XENLA Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 1 369 6.0E-32
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6811
MIRESNGNVTAHQWSASQQQWINVGTVVDAVGSTGKKVEYNGQSYDYVFDVDIEDGKPPLKLPYNLSENPYERAT
KFLHDNELPLSYLDNVANFITENTKGATLGQSAQQAGPDPYGTESRYRPGETSQPGAKVLPQKEYLSISAAKYEA
IFTKIFGINKNMVSSGRKDVALNPGEESILSSLREALETSKPIPPGALELIVKIVTLWPYGDRLPGLDVLRCLAR
YPLAAQYSGPRGETLLDVAISVSLPSESPLNENMVMMSTRTLANLFGSADGRSLASSRAEKAISFLERLAGIQGG
EAVGRFNRNVLIALMTSALNFAVLVYREKLLTHDQRRRLLVIVGTAMKDQTDSEVLYRALVALGTMLAAAAADAD
GLKVKEWVRAAKDQGNEARVASVADECLSRAP*
Coding >Hirsu2|6811
ATGATCAGGGAGAGTAACGGCAACGTGACAGCCCACCAGTGGTCGGCGAGCCAGCAGCAATGGATCAATGTCGGC
ACCGTGGTCGACGCTGTTGGAAGCACTGGCAAAAAGGTGGAATACAACGGACAGTCGTACGACTACGTATTCGAC
GTCGACATTGAGGATGGCAAGCCTCCCCTCAAGCTTCCGTATAATCTTTCCGAGAATCCCTACGAGCGAGCAACC
AAATTCCTCCACGACAACGAGCTCCCCTTGAGTTATCTGGACAATGTCGCAAACTTCATTACCGAAAACACCAAA
GGCGCCACTCTAGGCCAGTCGGCCCAACAAGCCGGGCCAGATCCATATGGCACGGAATCTCGCTACCGACCCGGC
GAGACGTCGCAGCCCGGGGCCAAAGTACTACCTCAGAAGGAGTACCTGAGCATCTCGGCAGCCAAGTACGAAGCC
ATCTTCACCAAGATCTTCGGAATCAACAAAAACATGGTGTCATCGGGCCGGAAAGACGTAGCTCTCAACCCGGGC
GAGGAGTCGATACTCAGCTCGCTGCGAGAGGCGCTTGAGACTTCCAAACCCATCCCGCCGGGAGCTTTGGAGCTG
ATCGTCAAGATTGTCACGCTGTGGCCATACGGCGACCGACTACCGGGTCTAGACGTCCTGCGCTGCTTGGCCAGA
TATCCGCTCGCGGCGCAGTACTCGGGCCCACGAGGCGAAACGCTGCTCGACGTAGCCATCAGTGTGTCTCTTCCC
TCCGAATCGCCTCTCAACGAGAACATGGTTATGATGAGCACGCGGACGCTCGCCAATTTGTTCGGCTCGGCCGAC
GGCCGCAGCCTGGCCAGCTCGCGGGCGGAGAAAGCAATCTCCTTCCTCGAGCGGCTGGCCGGCATTCAAGGTGGC
GAAGCCGTCGGCAGATTCAACCGCAACGTGCTCATCGCGCTGATGACGTCGGCCCTCAACTTCGCCGTCCTCGTC
TACCGGGAGAAGCTCCTAACGCACGACCAGCGCCGGCGCCTGCTCGTCATCGTCGGCACGGCGATGAAGGACCAG
ACGGATTCCGAGGTCTTGTACCGCGCTCTCGTGGCCCTCGGCACGATGCTCGCGGCGGCGGCGGCCGATGCCGAC
GGTCTCAAGGTGAAGGAATGGGTCCGGGCGGCCAAGGACCAAGGCAACGAGGCGAGGGTCGCCAGCGTGGCCGAC
GAGTGCCTATCGCGGGCGCCGTAG
Transcript >Hirsu2|6811
ATGATCAGGGAGAGTAACGGCAACGTGACAGCCCACCAGTGGTCGGCGAGCCAGCAGCAATGGATCAATGTCGGC
ACCGTGGTCGACGCTGTTGGAAGCACTGGCAAAAAGGTGGAATACAACGGACAGTCGTACGACTACGTATTCGAC
GTCGACATTGAGGATGGCAAGCCTCCCCTCAAGCTTCCGTATAATCTTTCCGAGAATCCCTACGAGCGAGCAACC
AAATTCCTCCACGACAACGAGCTCCCCTTGAGTTATCTGGACAATGTCGCAAACTTCATTACCGAAAACACCAAA
GGCGCCACTCTAGGCCAGTCGGCCCAACAAGCCGGGCCAGATCCATATGGCACGGAATCTCGCTACCGACCCGGC
GAGACGTCGCAGCCCGGGGCCAAAGTACTACCTCAGAAGGAGTACCTGAGCATCTCGGCAGCCAAGTACGAAGCC
ATCTTCACCAAGATCTTCGGAATCAACAAAAACATGGTGTCATCGGGCCGGAAAGACGTAGCTCTCAACCCGGGC
GAGGAGTCGATACTCAGCTCGCTGCGAGAGGCGCTTGAGACTTCCAAACCCATCCCGCCGGGAGCTTTGGAGCTG
ATCGTCAAGATTGTCACGCTGTGGCCATACGGCGACCGACTACCGGGTCTAGACGTCCTGCGCTGCTTGGCCAGA
TATCCGCTCGCGGCGCAGTACTCGGGCCCACGAGGCGAAACGCTGCTCGACGTAGCCATCAGTGTGTCTCTTCCC
TCCGAATCGCCTCTCAACGAGAACATGGTTATGATGAGCACGCGGACGCTCGCCAATTTGTTCGGCTCGGCCGAC
GGCCGCAGCCTGGCCAGCTCGCGGGCGGAGAAAGCAATCTCCTTCCTCGAGCGGCTGGCCGGCATTCAAGGTGGC
GAAGCCGTCGGCAGATTCAACCGCAACGTGCTCATCGCGCTGATGACGTCGGCCCTCAACTTCGCCGTCCTCGTC
TACCGGGAGAAGCTCCTAACGCACGACCAGCGCCGGCGCCTGCTCGTCATCGTCGGCACGGCGATGAAGGACCAG
ACGGATTCCGAGGTCTTGTACCGCGCTCTCGTGGCCCTCGGCACGATGCTCGCGGCGGCGGCGGCCGATGCCGAC
GGTCTCAAGGTGAAGGAATGGGTCCGGGCGGCCAAGGACCAAGGCAACGAGGCGAGGGTCGCCAGCGTGGCCGAC
GAGTGCCTATCGCGGGCGCCGTAG
Gene >Hirsu2|6811
ATGATCAGGGAGAGTAACGGCAACGTGACAGCCCACCAGTGGTCGGCGAGCCAGCAGCAATGGATCAATGTCGGC
ACCGTGGTCGACGCTGTTGGAAGCACTGGCAAAAAGGTGGAATACAACGGACAGTCGTACGACTACGTATTCGAC
GTCGACATTGAGGATGGCAAGCCTCCCCTCAAGCTTCCGTATAATCTTTCCGAGAATCCCTACGAGCGAGCAACC
AAATTCCTCCACGACAACGAGCTCCCCTTGAGTTATCTGGACAATGTCGCAAACTTCATTACCGAAAACACCAAA
GGCGCCACTCTAGGCCAGTCGGCCCAACAAGCCGGGCCAGATCCATATGGCACGGAATCTCGCTACCGACCCGGC
GAGACGTCGCAGCCCGGGGCCAAAGTACTACCTCAGAAGGAGTACCTGAGCATCTCGGCAGCCAAGTACGAAGGT
GAGATTGCAGCCGGTTGAAGCAAATCTGCACTGTTTTGCTAAAACGATGTGTCGCTGTAGCCATCTTCACCAAGA
TCTTCGGAATCAACAAAAACATGGTGTCATCGGGCCGGAAAGACGTAGCTCTCAACCCGGGCGAGGAGTCGATAC
TCAGCTCGCTGCGAGAGGCGCTTGAGACTTCCAAACCCATCCCGCCGGGAGCTTTGGAGCTGATCGTCAAGATTG
TCACGCTGTGGCCATACGGCGACCGACTACCGGGTCTAGACGTCCTGCGCTGCTTGGCCAGATATCCGCTCGCGG
CGCAGTACTCGGGCCCACGAGGCGAAACGCTGCTCGACGTAGCCATCAGTGTGTCTCTTCCCTCCGAATCGCCTC
TCAACGAGAACATGGTTATGATGAGCACGCGGACGCTCGCCAATTTGTTCGGCTCGGCCGACGGCCGCAGCCTGG
CCAGCTCGCGGGCGGAGAAAGCAATCTCCTTCCTCGAGCGGCTGGCCGGCATTCAAGGTGGCGAAGCCGTCGGCA
GATTCAACCGCAACGTGCTCATCGCGCTGATGACGTCGGCCCTCAACTTCGCCGTCCTCGTCTACCGGGAGAAGC
TCCTAACGCACGACCAGCGCCGGCGCCTGCTCGTCATCGTCGGCACGGCGATGAAGGACCAGACGGATTCCGAGG
TCTTGTACCGCGCTCTCGTGGCCCTCGGCACGATGCTCGCGGCGGCGGCGGCCGATGCCGACGGTCTCAAGGTGA
AGGAATGGGTCCGGGCGGCCAAGGACCAAGGCAACGAGGCGAGGGTCGCCAGCGTGGCCGACGAGTGCCTATCGC
GGGCGCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail