Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|681
Gene name
LocationContig_1138:3129..7612
Strand+
Gene length (bp)4483
Transcript length (bp)4335
Coding sequence length (bp)4335
Protein length (aa) 1445

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13637 Ank_4 Ankyrin repeats (many copies) 6.5E-11 1005 1055
PF00023 Ank Ankyrin repeat 3.3E-05 1003 1033
PF00023 Ank Ankyrin repeat 2.9E-05 1036 1065
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.5E-11 977 1065
PF13857 Ank_5 Ankyrin repeats (many copies) 2.5E-10 1022 1075
PF13606 Ank_3 Ankyrin repeat 2.5E-03 1036 1062
PF01833 TIG IPT/TIG domain 3.2E-08 815 879

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40578|MGA2_YEAST Protein MGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGA2 PE=1 SV=1 815 1188 5.0E-33
sp|P35210|SPT23_YEAST Protein SPT23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT23 PE=1 SV=2 746 1099 3.0E-32
sp|O13987|YEG5_SCHPO Ankyrin and IPT/TIG repeat-containing protein C26H5.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.05 PE=3 SV=1 815 1090 6.0E-28
sp|P40578|MGA2_YEAST Protein MGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGA2 PE=1 SV=1 314 553 9.0E-20
sp|P35210|SPT23_YEAST Protein SPT23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT23 PE=1 SV=2 311 601 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40578|MGA2_YEAST Protein MGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGA2 PE=1 SV=1 815 1188 5.0E-33
sp|P35210|SPT23_YEAST Protein SPT23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT23 PE=1 SV=2 746 1099 3.0E-32
sp|O13987|YEG5_SCHPO Ankyrin and IPT/TIG repeat-containing protein C26H5.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.05 PE=3 SV=1 815 1090 6.0E-28
sp|P40578|MGA2_YEAST Protein MGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGA2 PE=1 SV=1 314 553 9.0E-20
sp|P35210|SPT23_YEAST Protein SPT23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT23 PE=1 SV=2 311 601 2.0E-19
sp|A2AQH4|BCORL_MOUSE BCL-6 corepressor-like protein 1 OS=Mus musculus GN=Bcorl1 PE=2 SV=1 1002 1085 5.0E-09
sp|Q5H9F3|BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens GN=BCORL1 PE=1 SV=1 965 1085 5.0E-09
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 1007 1076 6.0E-09
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 1007 1076 7.0E-09
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 1007 1076 7.0E-09
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 1007 1076 8.0E-09
sp|Q6W2J9|BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens GN=BCOR PE=1 SV=1 959 1078 9.0E-09
sp|Q8CGN4|BCOR_MOUSE BCL-6 corepressor OS=Mus musculus GN=Bcor PE=1 SV=2 959 1078 1.0E-08
sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 1003 1087 2.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 962 1071 8.0E-08
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 1003 1112 1.0E-07
sp|Q5RJK8|ACBD6_RAT Acyl-CoA-binding domain-containing protein 6 OS=Rattus norvegicus GN=Acbd6 PE=1 SV=1 986 1089 1.0E-07
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 950 1119 1.0E-07
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 962 1071 2.0E-07
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 1003 1112 2.0E-07
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 998 1081 2.0E-07
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 1007 1100 3.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 1007 1100 3.0E-07
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 1002 1090 3.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 962 1125 3.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 955 1086 3.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1003 1072 4.0E-07
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 950 1077 4.0E-07
sp|Q4V8X4|ACBD6_DANRE Acyl-CoA-binding domain-containing protein 6 OS=Danio rerio GN=acbd6 PE=2 SV=1 1003 1087 4.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 962 1071 4.0E-07
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 995 1071 4.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 1003 1072 4.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 962 1125 4.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 962 1071 4.0E-07
sp|Q66JD7|ACBD6_XENTR Acyl-CoA-binding domain-containing protein 6 OS=Xenopus tropicalis GN=acbd6 PE=2 SV=1 982 1087 5.0E-07
sp|Q9D061|ACBD6_MOUSE Acyl-CoA-binding domain-containing protein 6 OS=Mus musculus GN=Acbd6 PE=1 SV=2 1003 1089 5.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 962 1071 6.0E-07
sp|Q5W7F2|AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana GN=AGD3 PE=1 SV=1 986 1076 6.0E-07
sp|Q4V869|ACBD6_XENLA Acyl-CoA-binding domain-containing protein 6 OS=Xenopus laevis GN=acbd6 PE=2 SV=1 982 1087 7.0E-07
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 992 1079 9.0E-07
sp|Q29Q26|AKR2B_ARATH Ankyrin repeat domain-containing protein 2B OS=Arabidopsis thaliana GN=AKR2B PE=1 SV=1 998 1086 1.0E-06
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 1003 1110 1.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1003 1101 1.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 962 1076 1.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 960 1086 1.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 1003 1071 1.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 960 1086 1.0E-06
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 950 1119 2.0E-06
sp|O00221|IKBE_HUMAN NF-kappa-B inhibitor epsilon OS=Homo sapiens GN=NFKBIE PE=1 SV=3 950 1082 2.0E-06
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 998 1071 2.0E-06
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 962 1102 2.0E-06
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 998 1081 2.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 962 1076 2.0E-06
sp|Q9UVH3|AKR1_MORAP Palmitoyltransferase AKR1 (Fragment) OS=Mortierella alpina PE=3 SV=1 1001 1080 3.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 997 1071 4.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 927 1100 4.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 1007 1077 5.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 997 1071 5.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 1007 1085 6.0E-06
sp|A9JR78|TONSL_DANRE Tonsoku-like protein OS=Danio rerio GN=tonsl PE=2 SV=1 1002 1074 6.0E-06
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 962 1075 6.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 962 1076 6.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 1001 1071 7.0E-06
sp|O54910|IKBE_MOUSE NF-kappa-B inhibitor epsilon OS=Mus musculus GN=Nfkbie PE=1 SV=2 905 1077 9.0E-06
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 980 1089 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 1391 1413 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|681
MTPARGPGPGPGSPLIAGAGMSTGELRDFDDDLSRVYNPFNFSDSPDGLQSLDVIGSSHQKTFLNPQDLTADPLP
DSPNESYQDSSSESASSSKRAGSSDSLKPTPAAAADLALDDCLDVKMEWPQAEYSAFDDDEQAFAFGAAVTPAAL
MDGFGFGDHDDAFMDPAFDMAGTSNSPEGPLPGPVSMPSPEMPIIKTNSPRRPNQAQQQRAGASHRKQISQYSMA
GSPSGVKSTGSREVSPMSALVTSHHSSPAAHFLHSPQPSGGHHFSRAVHDGPTWLNGVDVASPPVPQPDAVPAAV
PLAGHMMQAPPVPQPLPLFNAAPPDAPGGYELRIMPTSLKSRVETQIHIQMTLAPLPPGVTKLHLPAHTISKPKF
LVKPPPERSPDTLELSVSLVCTSAMQQPGIRQKALDRAARVPQSYLPAEHDDEDSPQNGGEVRICANCISRERKR
AARKKVRRPEEDKMWSLDEGRRVIVFNTQEVKEWQPLSRALDPSGRPETTASGHVMQITAPMRIACYCRHHSEKM
GFSVIFTLKDFRNRLIAQATSNSIMITDDHKTHPIAQAASQAAAAPEAAATSAAPAPDANGLVPSAHDEAAFLMS
TPKGDLGDAAQRHGRRASQPSPMLSVKSTPVAMPNRTLSRPASPSQGGPAAKKRKSSGSAPRVPNGLAMTRLETP
PAPSPQNAGPQQSAAASPFSPSQAPFPSLEPLFAHQPPFGNNGGTGPPTPGGTDQGSLYVGARSASVDSLALAHM
YPAASASNRPSRAPSPNGPRLDGPSPIPHLPFAPMLAANLDGFAMPAAANPAAVGANPAHSMTYIYKVIPNEGSK
SGGTEVTVLGHAFFPGLEVWFGENRATATTYWGDASLLCVLPPSHVAGNVPVTLRSALPAASQEAREISKERIMF
RYIDDTEDKLIRVALAVLGHKMSGQIIDASDVARRILNNNEGGNQNWTGGSSSAGQQTGAGSAFHQASHGQHLES
QLLKCLDLIDLDRSAHSSRLDLESPTSGHTMLHLACSLGYHRLVAALLARGANPDARDRGGFTPLHMAAMHDNSE
IVRRLMLKGADPTMRSLSGLTAADMSQSRRVLRAIRQSRRLTGSLSGSSLHSRASSAASLRSLWEPLTRARTHEE
PISADSSEESPEYTSGDFEDEDPDEDGGSLMMRRLSRGRHEAVEADDEGGGRPEAEPHGGPASPTTQFAAFKDQL
QQQLHQFQQSMALHLQSLPQMPQMPALPGMPMLPDYQAYLQQAPFVRRMQQLMPGSGARPGPPEGEDGGGKMDNR
WWDFTSYMQNSAVAPPSYEDIFGQRAAAASESKQESAMRAATEAEADMKCAAIYDQAAAAAAAAAAGGAGRAGAR
EKPPNVLKIGRKHAITKEQQEQFLLAHERKFKELSSDRNLFFIWIPLLVAMVCAMLYSYFPSLFPFLWTSVRALA
QAGLSRAWRAVQDGPRQAV*
Coding >Hirsu2|681
ATGACGCCTGCCAGAGGCCCCGGCCCCGGCCCCGGCAGCCCTCTCATAGCGGGGGCCGGCATGTCGACCGGCGAG
CTTCGCGACTTCGACGACGACTTGAGTCGAGTATACAACCCCTTCAACTTCTCCGACAGCCCGGACGGCCTCCAG
AGCCTCGACGTCATCGGCTCCAGCCATCAAAAGACCTTCCTGAACCCCCAGGACCTCACGGCCGACCCGCTCCCC
GACTCGCCCAACGAATCTTACCAAGACTCGTCGTCCGAGTCGGCATCCTCCTCCAAGAGAGCCGGCAGCTCCGAC
TCGCTCAAGCCCACGCCCGCCGCCGCCGCCGACCTGGCCCTCGACGACTGCCTCGACGTCAAGATGGAATGGCCC
CAGGCCGAGTACAGCGCGTTTGACGACGACGAGCAGGCCTTCGCCTTTGGCGCCGCCGTCACCCCGGCCGCCCTC
ATGGACGGCTTCGGCTTCGGCGACCACGACGACGCCTTCATGGATCCTGCCTTTGACATGGCCGGCACCTCCAAC
AGCCCCGAGGGCCCCCTGCCCGGCCCCGTCAGCATGCCCTCGCCCGAGATGCCCATCATCAAGACGAACAGCCCG
CGGAGGCCCAACCAGGCCCAGCAGCAGAGGGCCGGCGCCAGCCACAGGAAACAGATATCCCAATATTCGATGGCC
GGCTCCCCCAGCGGCGTCAAGTCGACCGGCTCGAGAGAGGTGTCTCCCATGTCCGCCCTGGTGACCAGCCACCAC
TCGTCCCCGGCTGCCCACTTTCTCCATTCTCCCCAGCCGAGCGGCGGCCATCACTTCTCGAGGGCCGTACACGAC
GGCCCGACGTGGCTCAACGGCGTCGACGTGGCCTCTCCTCCCGTTCCCCAGCCCGACGCCGTGCCCGCCGCCGTC
CCGCTCGCCGGGCACATGATGCAAGCACCGCCGGTCCCGCAACCGCTACCGCTCTTCAACGCGGCCCCGCCCGAC
GCCCCCGGCGGTTACGAGCTGAGAATCATGCCCACGTCCCTCAAGTCGCGTGTCGAGACGCAGATACATATCCAG
ATGACGCTGGCGCCCCTCCCTCCCGGGGTGACCAAACTGCACCTCCCGGCGCACACGATATCCAAGCCCAAATTC
CTGGTCAAGCCGCCCCCGGAGCGGTCGCCCGACACGCTCGAGCTCTCCGTCTCGCTCGTCTGCACGAGCGCCATG
CAGCAGCCCGGCATCAGGCAGAAGGCGCTCGACAGGGCCGCCAGGGTCCCGCAGAGCTACCTCCCCGCCGAGCAC
GACGACGAGGACTCGCCGCAGAACGGCGGCGAAGTCCGGATCTGTGCCAACTGCATCAGCAGGGAACGCAAGAGG
GCCGCGCGCAAGAAGGTCCGCCGGCCGGAGGAGGACAAGATGTGGAGCCTGGACGAGGGACGCCGCGTCATCGTC
TTCAACACGCAGGAGGTCAAGGAATGGCAGCCGCTCAGCCGCGCCCTGGATCCAAGCGGCCGGCCCGAGACGACG
GCGTCCGGCCACGTGATGCAGATCACGGCGCCCATGCGCATCGCATGCTACTGCCGGCATCACAGCGAGAAGATG
GGCTTCAGCGTCATCTTCACCCTCAAGGATTTCCGCAATCGTCTCATCGCGCAGGCCACGTCCAATTCCATCATG
ATCACTGACGACCACAAGACGCATCCCATCGCGCAGGCAGCCTCCCAGGCGGCCGCCGCACCCGAGGCCGCCGCG
ACGTCGGCGGCGCCCGCCCCCGACGCGAACGGCCTCGTGCCGTCTGCCCACGACGAAGCGGCCTTCCTCATGTCG
ACCCCGAAAGGCGACCTGGGCGACGCGGCCCAACGCCACGGACGGCGGGCCTCGCAGCCTTCCCCCATGCTGTCC
GTCAAATCGACGCCGGTGGCGATGCCGAACCGGACACTGTCCCGGCCCGCGTCGCCCAGCCAGGGCGGCCCCGCG
GCCAAGAAGAGAAAGTCGAGCGGGAGCGCACCCCGCGTTCCCAACGGACTGGCCATGACGAGGCTGGAGACGCCG
CCCGCCCCAAGCCCCCAGAACGCCGGCCCGCAGCAGTCGGCCGCCGCATCGCCCTTCTCGCCGAGCCAGGCTCCC
TTCCCGTCGCTGGAGCCCCTGTTCGCGCATCAGCCGCCGTTCGGCAACAACGGCGGCACCGGCCCTCCCACCCCC
GGCGGCACGGACCAAGGCTCGTTGTACGTGGGGGCCCGGTCGGCGAGCGTGGACAGCCTGGCGCTGGCCCACATG
TACCCGGCAGCGTCGGCGTCGAACCGCCCCAGCCGCGCGCCGAGCCCCAACGGCCCCAGACTGGACGGCCCGAGC
CCGATACCGCATCTTCCGTTCGCCCCGATGCTCGCGGCCAACCTCGACGGGTTCGCGATGCCCGCCGCCGCGAAC
CCGGCGGCGGTGGGAGCGAATCCCGCCCACTCGATGACGTACATTTATAAGGTAATCCCCAACGAGGGCTCCAAG
TCGGGCGGAACGGAGGTGACGGTGCTGGGACACGCCTTCTTCCCGGGCCTGGAGGTCTGGTTCGGCGAGAACCGG
GCGACGGCGACGACCTACTGGGGCGACGCGTCGCTGCTCTGCGTCCTGCCGCCGTCCCACGTGGCCGGAAACGTG
CCCGTCACGCTGAGGTCGGCGCTGCCGGCGGCCTCGCAAGAGGCCCGAGAGATATCCAAGGAACGGATCATGTTC
CGGTACATCGACGACACCGAGGACAAGCTGATCCGGGTAGCGCTGGCCGTGCTCGGTCATAAGATGTCGGGCCAA
ATCATCGACGCCAGCGACGTGGCCCGGAGGATCCTCAACAACAACGAGGGCGGCAACCAGAACTGGACCGGCGGA
TCGTCGTCGGCGGGGCAGCAGACGGGCGCCGGATCCGCGTTCCACCAGGCCTCGCACGGACAGCACCTGGAGTCG
CAGCTGCTCAAGTGCCTGGATCTGATCGACCTCGACCGCAGCGCGCACAGCTCGCGACTCGACCTGGAGTCGCCG
ACGAGCGGGCACACGATGCTCCACCTCGCCTGCTCGCTCGGATACCACCGACTCGTGGCGGCCCTGCTGGCCCGG
GGGGCGAACCCCGACGCCAGGGACCGGGGCGGCTTCACCCCGCTGCACATGGCGGCGATGCACGACAACTCGGAG
ATTGTGAGGCGGCTGATGCTCAAGGGGGCGGATCCCACCATGCGAAGCCTGTCGGGCCTGACGGCCGCCGACATG
AGCCAGTCGAGGAGGGTGCTGCGCGCCATCCGCCAGTCCCGCCGCCTCACGGGATCCCTCAGCGGGTCGTCGCTG
CACAGCCGGGCCAGCAGCGCGGCCTCGCTGCGGTCGCTCTGGGAGCCGCTGACCAGGGCGCGCACGCACGAGGAG
CCGATATCGGCCGACTCGAGCGAGGAGAGCCCCGAGTACACGTCGGGCGACTTCGAGGACGAGGACCCCGACGAG
GATGGCGGCAGCCTCATGATGCGGCGTCTCAGCCGCGGACGGCACGAGGCGGTCGAGGCCGACGACGAGGGCGGC
GGCAGGCCCGAAGCGGAACCGCACGGCGGCCCCGCATCGCCGACGACGCAGTTCGCGGCCTTTAAGGACCAGCTC
CAGCAGCAGCTGCACCAGTTCCAGCAGTCGATGGCGCTGCACCTGCAAAGCCTGCCGCAGATGCCGCAGATGCCG
GCCCTGCCGGGCATGCCGATGCTGCCCGACTACCAGGCGTACCTGCAGCAGGCGCCGTTCGTGCGGCGCATGCAG
CAGCTGATGCCGGGATCCGGCGCCCGGCCCGGACCGCCGGAGGGGGAGGACGGCGGCGGCAAGATGGACAACCGC
TGGTGGGACTTCACGTCGTACATGCAGAACAGCGCCGTGGCGCCGCCCTCGTACGAAGACATCTTCGGCCAGCGT
GCGGCGGCGGCGTCGGAGTCGAAACAAGAGTCGGCGATGCGGGCGGCGACGGAGGCCGAGGCCGACATGAAGTGC
GCCGCCATCTACGACCAAGCAGCAGCGGCGGCGGCGGCGGCGGCGGCGGGCGGGGCGGGGCGAGCGGGAGCCAGG
GAGAAGCCGCCCAACGTGCTCAAGATCGGGCGGAAGCACGCCATCACCAAGGAGCAGCAGGAGCAGTTCTTGCTT
GCCCACGAGCGGAAGTTCAAGGAGCTCAGCAGCGACCGAAATCTCTTTTTCATCTGGATTCCCCTCCTGGTGGCC
ATGGTCTGCGCCATGCTCTACAGCTACTTCCCATCGCTGTTCCCGTTCCTGTGGACGTCGGTGCGAGCGCTGGCG
CAGGCGGGACTGTCTCGGGCGTGGCGAGCGGTACAGGACGGGCCTCGACAGGCCGTCTGA
Transcript >Hirsu2|681
ATGACGCCTGCCAGAGGCCCCGGCCCCGGCCCCGGCAGCCCTCTCATAGCGGGGGCCGGCATGTCGACCGGCGAG
CTTCGCGACTTCGACGACGACTTGAGTCGAGTATACAACCCCTTCAACTTCTCCGACAGCCCGGACGGCCTCCAG
AGCCTCGACGTCATCGGCTCCAGCCATCAAAAGACCTTCCTGAACCCCCAGGACCTCACGGCCGACCCGCTCCCC
GACTCGCCCAACGAATCTTACCAAGACTCGTCGTCCGAGTCGGCATCCTCCTCCAAGAGAGCCGGCAGCTCCGAC
TCGCTCAAGCCCACGCCCGCCGCCGCCGCCGACCTGGCCCTCGACGACTGCCTCGACGTCAAGATGGAATGGCCC
CAGGCCGAGTACAGCGCGTTTGACGACGACGAGCAGGCCTTCGCCTTTGGCGCCGCCGTCACCCCGGCCGCCCTC
ATGGACGGCTTCGGCTTCGGCGACCACGACGACGCCTTCATGGATCCTGCCTTTGACATGGCCGGCACCTCCAAC
AGCCCCGAGGGCCCCCTGCCCGGCCCCGTCAGCATGCCCTCGCCCGAGATGCCCATCATCAAGACGAACAGCCCG
CGGAGGCCCAACCAGGCCCAGCAGCAGAGGGCCGGCGCCAGCCACAGGAAACAGATATCCCAATATTCGATGGCC
GGCTCCCCCAGCGGCGTCAAGTCGACCGGCTCGAGAGAGGTGTCTCCCATGTCCGCCCTGGTGACCAGCCACCAC
TCGTCCCCGGCTGCCCACTTTCTCCATTCTCCCCAGCCGAGCGGCGGCCATCACTTCTCGAGGGCCGTACACGAC
GGCCCGACGTGGCTCAACGGCGTCGACGTGGCCTCTCCTCCCGTTCCCCAGCCCGACGCCGTGCCCGCCGCCGTC
CCGCTCGCCGGGCACATGATGCAAGCACCGCCGGTCCCGCAACCGCTACCGCTCTTCAACGCGGCCCCGCCCGAC
GCCCCCGGCGGTTACGAGCTGAGAATCATGCCCACGTCCCTCAAGTCGCGTGTCGAGACGCAGATACATATCCAG
ATGACGCTGGCGCCCCTCCCTCCCGGGGTGACCAAACTGCACCTCCCGGCGCACACGATATCCAAGCCCAAATTC
CTGGTCAAGCCGCCCCCGGAGCGGTCGCCCGACACGCTCGAGCTCTCCGTCTCGCTCGTCTGCACGAGCGCCATG
CAGCAGCCCGGCATCAGGCAGAAGGCGCTCGACAGGGCCGCCAGGGTCCCGCAGAGCTACCTCCCCGCCGAGCAC
GACGACGAGGACTCGCCGCAGAACGGCGGCGAAGTCCGGATCTGTGCCAACTGCATCAGCAGGGAACGCAAGAGG
GCCGCGCGCAAGAAGGTCCGCCGGCCGGAGGAGGACAAGATGTGGAGCCTGGACGAGGGACGCCGCGTCATCGTC
TTCAACACGCAGGAGGTCAAGGAATGGCAGCCGCTCAGCCGCGCCCTGGATCCAAGCGGCCGGCCCGAGACGACG
GCGTCCGGCCACGTGATGCAGATCACGGCGCCCATGCGCATCGCATGCTACTGCCGGCATCACAGCGAGAAGATG
GGCTTCAGCGTCATCTTCACCCTCAAGGATTTCCGCAATCGTCTCATCGCGCAGGCCACGTCCAATTCCATCATG
ATCACTGACGACCACAAGACGCATCCCATCGCGCAGGCAGCCTCCCAGGCGGCCGCCGCACCCGAGGCCGCCGCG
ACGTCGGCGGCGCCCGCCCCCGACGCGAACGGCCTCGTGCCGTCTGCCCACGACGAAGCGGCCTTCCTCATGTCG
ACCCCGAAAGGCGACCTGGGCGACGCGGCCCAACGCCACGGACGGCGGGCCTCGCAGCCTTCCCCCATGCTGTCC
GTCAAATCGACGCCGGTGGCGATGCCGAACCGGACACTGTCCCGGCCCGCGTCGCCCAGCCAGGGCGGCCCCGCG
GCCAAGAAGAGAAAGTCGAGCGGGAGCGCACCCCGCGTTCCCAACGGACTGGCCATGACGAGGCTGGAGACGCCG
CCCGCCCCAAGCCCCCAGAACGCCGGCCCGCAGCAGTCGGCCGCCGCATCGCCCTTCTCGCCGAGCCAGGCTCCC
TTCCCGTCGCTGGAGCCCCTGTTCGCGCATCAGCCGCCGTTCGGCAACAACGGCGGCACCGGCCCTCCCACCCCC
GGCGGCACGGACCAAGGCTCGTTGTACGTGGGGGCCCGGTCGGCGAGCGTGGACAGCCTGGCGCTGGCCCACATG
TACCCGGCAGCGTCGGCGTCGAACCGCCCCAGCCGCGCGCCGAGCCCCAACGGCCCCAGACTGGACGGCCCGAGC
CCGATACCGCATCTTCCGTTCGCCCCGATGCTCGCGGCCAACCTCGACGGGTTCGCGATGCCCGCCGCCGCGAAC
CCGGCGGCGGTGGGAGCGAATCCCGCCCACTCGATGACGTACATTTATAAGGTAATCCCCAACGAGGGCTCCAAG
TCGGGCGGAACGGAGGTGACGGTGCTGGGACACGCCTTCTTCCCGGGCCTGGAGGTCTGGTTCGGCGAGAACCGG
GCGACGGCGACGACCTACTGGGGCGACGCGTCGCTGCTCTGCGTCCTGCCGCCGTCCCACGTGGCCGGAAACGTG
CCCGTCACGCTGAGGTCGGCGCTGCCGGCGGCCTCGCAAGAGGCCCGAGAGATATCCAAGGAACGGATCATGTTC
CGGTACATCGACGACACCGAGGACAAGCTGATCCGGGTAGCGCTGGCCGTGCTCGGTCATAAGATGTCGGGCCAA
ATCATCGACGCCAGCGACGTGGCCCGGAGGATCCTCAACAACAACGAGGGCGGCAACCAGAACTGGACCGGCGGA
TCGTCGTCGGCGGGGCAGCAGACGGGCGCCGGATCCGCGTTCCACCAGGCCTCGCACGGACAGCACCTGGAGTCG
CAGCTGCTCAAGTGCCTGGATCTGATCGACCTCGACCGCAGCGCGCACAGCTCGCGACTCGACCTGGAGTCGCCG
ACGAGCGGGCACACGATGCTCCACCTCGCCTGCTCGCTCGGATACCACCGACTCGTGGCGGCCCTGCTGGCCCGG
GGGGCGAACCCCGACGCCAGGGACCGGGGCGGCTTCACCCCGCTGCACATGGCGGCGATGCACGACAACTCGGAG
ATTGTGAGGCGGCTGATGCTCAAGGGGGCGGATCCCACCATGCGAAGCCTGTCGGGCCTGACGGCCGCCGACATG
AGCCAGTCGAGGAGGGTGCTGCGCGCCATCCGCCAGTCCCGCCGCCTCACGGGATCCCTCAGCGGGTCGTCGCTG
CACAGCCGGGCCAGCAGCGCGGCCTCGCTGCGGTCGCTCTGGGAGCCGCTGACCAGGGCGCGCACGCACGAGGAG
CCGATATCGGCCGACTCGAGCGAGGAGAGCCCCGAGTACACGTCGGGCGACTTCGAGGACGAGGACCCCGACGAG
GATGGCGGCAGCCTCATGATGCGGCGTCTCAGCCGCGGACGGCACGAGGCGGTCGAGGCCGACGACGAGGGCGGC
GGCAGGCCCGAAGCGGAACCGCACGGCGGCCCCGCATCGCCGACGACGCAGTTCGCGGCCTTTAAGGACCAGCTC
CAGCAGCAGCTGCACCAGTTCCAGCAGTCGATGGCGCTGCACCTGCAAAGCCTGCCGCAGATGCCGCAGATGCCG
GCCCTGCCGGGCATGCCGATGCTGCCCGACTACCAGGCGTACCTGCAGCAGGCGCCGTTCGTGCGGCGCATGCAG
CAGCTGATGCCGGGATCCGGCGCCCGGCCCGGACCGCCGGAGGGGGAGGACGGCGGCGGCAAGATGGACAACCGC
TGGTGGGACTTCACGTCGTACATGCAGAACAGCGCCGTGGCGCCGCCCTCGTACGAAGACATCTTCGGCCAGCGT
GCGGCGGCGGCGTCGGAGTCGAAACAAGAGTCGGCGATGCGGGCGGCGACGGAGGCCGAGGCCGACATGAAGTGC
GCCGCCATCTACGACCAAGCAGCAGCGGCGGCGGCGGCGGCGGCGGCGGGCGGGGCGGGGCGAGCGGGAGCCAGG
GAGAAGCCGCCCAACGTGCTCAAGATCGGGCGGAAGCACGCCATCACCAAGGAGCAGCAGGAGCAGTTCTTGCTT
GCCCACGAGCGGAAGTTCAAGGAGCTCAGCAGCGACCGAAATCTCTTTTTCATCTGGATTCCCCTCCTGGTGGCC
ATGGTCTGCGCCATGCTCTACAGCTACTTCCCATCGCTGTTCCCGTTCCTGTGGACGTCGGTGCGAGCGCTGGCG
CAGGCGGGACTGTCTCGGGCGTGGCGAGCGGTACAGGACGGGCCTCGACAGGCCGTCTGA
Gene >Hirsu2|681
ATGACGCCTGCCAGAGGCCCCGGCCCCGGCCCCGGCAGCCCTCTCATAGCGGGGGCCGGCATGTCGACCGGCGAG
CTTCGCGACTTCGACGACGACTTGAGTCGAGTATACAACCCCTTCAACTTCTCCGACAGCCCGGACGGCCTCCAG
AGCCTCGACGTCATCGGCTCCAGCCATCAAAAGACCTTCCTGAACCCCCAGGACCTCACGGCCGACCCGCTCCCC
GACTCGCCCAACGAATCTTACCAAGACTCGTCGTCCGAGTCGGCATCCTCCTCCAAGAGAGCCGGCAGCTCCGAC
TCGCTCAAGCCCACGCCCGCCGCCGCCGCCGACCTGGCCCTCGACGACTGCCTCGACGTCAAGATGGAATGGCCC
CAGGCCGAGTACAGCGCGTTTGACGACGACGAGCAGGCCTTCGCCTTTGGCGCCGCCGTCACCCCGGCCGCCCTC
ATGGACGGCTTCGGCTTCGGCGACCACGACGACGCCTTCATGGATCCTGCCTTTGACATGGCCGGCACCTCCAAC
AGCCCCGAGGGCCCCCTGCCCGGCCCCGTCAGCATGCCCTCGCCCGAGATGCCCATCATCAAGACGAACAGCCCG
CGGAGGCCCAACCAGGCCCAGCAGCAGAGGGCCGGCGCCAGCCACAGGAAACAGATATCCGTGAGTGCCTCTACC
CCGCCTGCTCCCGTCGCCCCAACCCTTGGGCCGCCCGCCCAAAGCTAACAGAGGGGGCCCCCTTCGCCCAGCAAT
ATTCGATGGCCGGCTCCCCCAGCGGCGTCAAGTCGACCGGCTCGAGAGAGGTGTCTCCCATGTCCGCCCTGGTGA
CCAGCCACCACTCGTCCCCGGCTGCCCACTTTCTCCATTCTCCCCAGCCGAGCGGCGGCCATCACTTCTCGAGGG
CCGTACACGACGGCCCGACGTGGCTCAACGGCGTCGACGTGGCCTCTCCTCCCGTTCCCCAGCCCGACGCCGTGC
CCGCCGCCGTCCCGCTCGCCGGGCACATGATGCAAGCACCGCCGGTCCCGCAACCGCTACCGCTCTTCAACGCGG
CCCCGCCCGACGCCCCCGGCGGTTACGAGCTGAGAATCATGCCCACGTCCCTCAAGTCGCGTGTCGAGACGCAGA
TACATATCCAGATGACGCTGGCGCCCCTCCCTCCCGGGGTGACCAAACTGCACCTCCCGGCGCACACGATATCCA
AGCCCAAATTCCTGGTCAAGCCGCCCCCGGAGCGGTCGCCCGACACGCTCGAGCTCTCCGTCTCGCTCGTCTGCA
CGAGCGCCATGCAGCAGCCCGGCATCAGGCAGAAGGCGCTCGACAGGGCCGCCAGGGTCCCGCAGAGCTACCTCC
CCGCCGAGCACGACGACGAGGACTCGCCGCAGAACGGCGGCGAAGTCCGGATCTGTGCCAACTGCATCAGCAGGG
AACGCAAGAGGGCCGCGCGCAAGAAGGTCCGCCGGCCGGAGGAGGACAAGATGTGGAGCCTGGACGAGGGACGCC
GCGTCATCGTCTTCAACACGCAGGAGGTCAAGGAATGGCAGCCGCTCAGCCGCGCCCTGGATCCAAGCGGCCGGC
CCGAGACGACGGCGTCCGGCCACGTGATGCAGATCACGGCGCCCATGCGCATCGCATGCTACTGCCGGCATCACA
GCGAGAAGATGGGCTTCAGCGTCATCTTCACCCTCAAGGATTTCCGCAATCGTCTCATCGCGCAGGCCACGTCCA
ATTCCATCATGATCACTGACGACCACAAGACGCATCCCATCGCGCAGGCAGCCTCCCAGGCGGCCGCCGCACCCG
AGGCCGCCGCGACGTCGGCGGCGCCCGCCCCCGACGCGAACGGCCTCGTGCCGTCTGCCCACGACGAAGCGGCCT
TCCTCATGTCGACCCCGAAAGGCGACCTGGGCGACGCGGCCCAACGCCACGGACGGCGGGCCTCGCAGCCTTCCC
CCATGCTGTCCGTCAAATCGACGCCGGTGGCGATGCCGAACCGGACACTGTCCCGGCCCGCGTCGCCCAGCCAGG
GCGGCCCCGCGGCCAAGAAGAGAAAGTCGAGCGGGAGCGCACCCCGCGTTCCCAACGGACTGGCCATGACGAGGC
TGGAGACGCCGCCCGCCCCAAGCCCCCAGAACGCCGGCCCGCAGCAGTCGGCCGCCGCATCGCCCTTCTCGCCGA
GCCAGGCTCCCTTCCCGTCGCTGGAGCCCCTGTTCGCGCATCAGCCGCCGTTCGGCAACAACGGCGGCACCGGCC
CTCCCACCCCCGGCGGCACGGACCAAGGCTCGTTGTACGTGGGGGCCCGGTCGGCGAGCGTGGACAGCCTGGCGC
TGGCCCACATGTACCCGGCAGCGTCGGCGTCGAACCGCCCCAGCCGCGCGCCGAGCCCCAACGGCCCCAGACTGG
ACGGCCCGAGCCCGATACCGCATCTTCCGTTCGCCCCGATGCTCGCGGCCAACCTCGACGGGTTCGCGATGCCCG
CCGCCGCGAACCCGGCGGCGGTGGGAGCGAATCCCGCCCACTCGATGACGTACATTTATAAGGTAATCCCCAACG
AGGGCTCCAAGTCGGGCGGAACGGAGGTGACGGTGCTGGGACACGCCTTCTTCCCGGGCCTGGAGGTCTGGTTCG
GCGAGAACCGGGCGACGGCGACGACCTACTGGGGCGACGCGTCGCTGCTCTGCGTCCTGCCGCCGTCCCACGTGG
CCGGAAACGTGCCCGTCACGCTGAGGTCGGCGCTGCCGGCGGCCTCGCAAGAGGCCCGAGAGATATCCAAGGAAC
GGATCATGTTCCGGTACATCGACGACACCGAGGACAAGCTGATCCGGGTAGCGCTGGCCGTGCTCGGTCATAAGA
TGTCGGGCCAAATCATCGACGCCAGCGACGTGGCCCGGAGGATCCTCAACAACAACGAGGGCGGCAACCAGAACT
GGACCGGCGGATCGTCGTCGGCGGGGCAGCAGACGGGCGCCGGATCCGCGTTCCACCAGGCCTCGCACGGACAGC
ACCTGGAGTCGCAGCTGCTCAAGTGCCTGGATCTGATCGACCTCGACCGCAGCGCGCACAGCTCGCGACTCGACC
TGGAGTCGCCGACGAGCGGGCACACGATGCTCCACCTCGCCTGCTCGCTCGGATACCACCGACTCGTGGCGGCCC
TGCTGGCCCGGGGGGCGAACCCCGACGCCAGGGACCGGGGCGGCTTCACCCCGCTGCACATGGCGGCGATGCACG
ACAACTCGGAGATTGTGAGGCGGCTGATGCTCAAGGGGGCGGATCCCACCATGCGAAGCCTGTCGGGCCTGACGG
CCGCCGACATGAGCCAGTCGAGGAGGGTGCTGCGCGCCATCCGCCAGTCCCGCCGCCTCACGGGATCCCTCAGCG
GGTCGTCGCTGCACAGCCGGGCCAGCAGCGCGGCCTCGCTGCGGTCGCTCTGGGAGCCGCTGACCAGGGCGCGCA
CGCACGAGGAGCCGATATCGGCCGACTCGAGCGAGGAGAGCCCCGAGTACACGTCGGGCGACTTCGAGGACGAGG
ACCCCGACGAGGATGGCGGCAGCCTCATGATGCGGCGTCTCAGCCGCGGACGGCACGAGGCGGTCGAGGCCGACG
ACGAGGGCGGCGGCAGGCCCGAAGCGGAACCGCACGGCGGCCCCGCATCGCCGACGACGCAGTTCGCGGCCTTTA
AGGACCAGCTCCAGCAGCAGCTGCACCAGTTCCAGCAGTCGATGGCGCTGCACCTGCAAAGCCTGCCGCAGATGC
CGCAGATGCCGGCCCTGCCGGGCATGCCGATGCTGCCCGACTACCAGGCGTACCTGCAGCAGGCGCCGTTCGTGC
GGCGCATGCAGCAGCTGATGCCGGGATCCGGCGCCCGGCCCGGACCGCCGGAGGGGGAGGACGGCGGCGGCAAGA
TGGACAACCGCTGGTGGGACTTCACGTCGTACATGCAGAACAGCGCCGTGGCGCCGCCCTCGTACGAAGACATCT
TCGGCCAGCGTGCGGCGGCGGCGTCGGAGTCGAAACAAGAGTCGGCGATGCGGGCGGCGACGGAGGCCGAGGCCG
ACATGAAGTGCGCCGCCATCTACGACCAAGCAGCAGCGGCGGCGGCGGCGGCGGCGGCGGGCGGGGCGGGGCGAG
CGGGAGCCAGGGAGAAGCCGCCCAACGTGCTCAAGATCGGGCGGAAGCACGCCATCACCAAGGAGCAGCAGGAGC
AGTTCTTGCTTGCCCACGAGCGGAAGTTCAAGGAGCTCAGCAGCGACCGAAATCTCTTTTTCATCTGGGTATGCC
CCCCCCCCCCCCCCTTTCCTCTTTTCGGCTGGTGGATCGCTGACGGCGGCGGCAGATTCCCCTCCTGGTGGCCAT
GGTCTGCGCCATGCTCTACAGCTACTTCCCATCGCTGTTCCCGTTCCTGTGGACGTCGGTGCGAGCGCTGGCGCA
GGCGGGACTGTCTCGGGCGTGGCGAGCGGTACAGGACGGGCCTCGACAGGCCGTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail