Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6807
Gene name
LocationContig_365:9251..11575
Strand-
Gene length (bp)2324
Transcript length (bp)2127
Coding sequence length (bp)2127
Protein length (aa) 709

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08487 VIT Vault protein inter-alpha-trypsin domain 3.5E-33 33 146
PF13768 VWA_3 von Willebrand factor type A domain 8.2E-27 301 457
PF13757 VIT_2 Vault protein inter-alpha-trypsin domain 3.7E-15 26 97
PF00092 VWA von Willebrand factor type A domain 2.5E-09 302 463
PF13519 VWA_2 von Willebrand factor type A domain 3.9E-07 302 407

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O00534|VMA5A_HUMAN von Willebrand factor A domain-containing protein 5A OS=Homo sapiens GN=VWA5A PE=2 SV=2 17 486 4.0E-45
sp|Q54DU5|Y2028_DICDI von Willebrand factor A domain-containing protein DDB_G0292028 OS=Dictyostelium discoideum GN=DDB_G0292028 PE=3 SV=1 65 483 2.0E-40
sp|Q99KC8|VMA5A_MOUSE von Willebrand factor A domain-containing protein 5A OS=Mus musculus GN=Vwa5a PE=1 SV=2 16 486 1.0E-39
sp|Q75WE7|VWA5A_RAT von Willebrand factor A domain-containing protein 5A OS=Rattus norvegicus GN=Vwa5a PE=2 SV=1 65 493 5.0E-39
sp|Q54DV3|Y2016_DICDI von Willebrand factor A domain-containing protein DDB_G0292016 OS=Dictyostelium discoideum GN=DDB_G0292016 PE=3 SV=1 12 486 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O00534|VMA5A_HUMAN von Willebrand factor A domain-containing protein 5A OS=Homo sapiens GN=VWA5A PE=2 SV=2 17 486 4.0E-45
sp|Q54DU5|Y2028_DICDI von Willebrand factor A domain-containing protein DDB_G0292028 OS=Dictyostelium discoideum GN=DDB_G0292028 PE=3 SV=1 65 483 2.0E-40
sp|Q99KC8|VMA5A_MOUSE von Willebrand factor A domain-containing protein 5A OS=Mus musculus GN=Vwa5a PE=1 SV=2 16 486 1.0E-39
sp|Q75WE7|VWA5A_RAT von Willebrand factor A domain-containing protein 5A OS=Rattus norvegicus GN=Vwa5a PE=2 SV=1 65 493 5.0E-39
sp|Q54DV3|Y2016_DICDI von Willebrand factor A domain-containing protein DDB_G0292016 OS=Dictyostelium discoideum GN=DDB_G0292016 PE=3 SV=1 12 486 1.0E-38
sp|Q54MG4|Y5975_DICDI von Willebrand factor A domain-containing protein DDB_G0285975 OS=Dictyostelium discoideum GN=DDB_G0285975 PE=3 SV=1 26 483 3.0E-32
sp|Q54MG1|Y5981_DICDI von Willebrand factor A domain-containing protein DDB_G0285981 OS=Dictyostelium discoideum GN=DDB_G0285981 PE=3 SV=1 26 483 1.0E-30
sp|Q9UKK3|PARP4_HUMAN Poly [ADP-ribose] polymerase 4 OS=Homo sapiens GN=PARP4 PE=1 SV=3 30 454 6.0E-29
sp|Q55G98|Y7758_DICDI von Willebrand factor A domain-containing protein DDB_G0267758 OS=Dictyostelium discoideum GN=DDB_G0267758 PE=3 SV=1 18 489 7.0E-28
sp|A9Z1V5|VW5B1_MOUSE von Willebrand factor A domain-containing protein 5B1 OS=Mus musculus GN=Vwa5b1 PE=2 SV=1 30 483 5.0E-26
sp|Q5TIE3|VW5B1_HUMAN von Willebrand factor A domain-containing protein 5B1 OS=Homo sapiens GN=VWA5B1 PE=1 SV=2 30 483 2.0E-24
sp|C7G046|Y6969_DICDI von Willebrand factor A domain-containing protein DDB_G0286969 OS=Dictyostelium discoideum GN=DDB_G0286969 PE=3 SV=1 256 483 4.0E-21
sp|Q54CQ8|Y2740_DICDI von Willebrand factor A domain-containing protein DDB_G0292740 OS=Dictyostelium discoideum GN=DDB_G0292740 PE=3 SV=1 299 486 4.0E-21
sp|Q8BJD1|ITIH5_MOUSE Inter-alpha-trypsin inhibitor heavy chain H5 OS=Mus musculus GN=Itih5 PE=1 SV=1 28 483 3.0E-10
sp|Q9GLY5|ITIH3_RABIT Inter-alpha-trypsin inhibitor heavy chain H3 OS=Oryctolagus cuniculus GN=ITIH3 PE=2 SV=1 65 459 5.0E-08
sp|Q06033|ITIH3_HUMAN Inter-alpha-trypsin inhibitor heavy chain H3 OS=Homo sapiens GN=ITIH3 PE=1 SV=2 65 469 6.0E-07
sp|P97280|ITIH3_MESAU Inter-alpha-trypsin inhibitor heavy chain H3 OS=Mesocricetus auratus GN=ITIH3 PE=1 SV=1 62 459 8.0E-07
sp|Q5RB37|ITIH3_PONAB Inter-alpha-trypsin inhibitor heavy chain H3 OS=Pongo abelii GN=ITIH3 PE=2 SV=1 37 146 1.0E-06
sp|Q61704|ITIH3_MOUSE Inter-alpha-trypsin inhibitor heavy chain H3 OS=Mus musculus GN=Itih3 PE=1 SV=3 65 459 2.0E-06
sp|A6X935|ITIH4_MOUSE Inter alpha-trypsin inhibitor, heavy chain 4 OS=Mus musculus GN=Itih4 PE=1 SV=2 294 461 3.0E-06
sp|Q63416|ITIH3_RAT Inter-alpha-trypsin inhibitor heavy chain H3 OS=Rattus norvegicus GN=Itih3 PE=2 SV=1 65 459 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6807
MAGFASFHSPPLALPQCGCFTIVGDQRKCLPLLDVHVHTSILSSASRTTLRQAFVNPDAQAQLGEVRYDFPLYDG
VSVVGFKCSIGRRVITGVIKERQEAKKAYESAINEGKVAALLNQDIRAADVFTAALGNVPAGARVEVEITYLGEL
EHDAEADCLRLTIPTSVAPRYDRTQVLTWAAHDAAGGVAQEVGNMSITVDVQMARECPIANIQSPSHPISVGIGK
TSAVSASADEPSSPQRASVSLALEAAQLDKDFVLMVAAAGLTSPVALVEAHPTIPHQQAVMATLVPRFNLPAGKP
EIVFVCDRSGSMGMGQKIPNLVAALQIFLKSLPVGVRFNICSFGSQHKFLWQKSQAYNQETLDKAVEHVQSFAAN
FGGTEMYQPLVDTFNRRSAETNLEVFLLTDGEVWEQTELFQVVDDHVGKSNGAIRIFTLGVGDQASSALVKGVAR
AGNGFAQMVSDHERMDKKIIRMLKGALTPHIKDYALGITYEGPGSDDGVASRREDLDDDFEIVGDALRGLSINTE
KGSGEKRENQAEPQGSDRRKEPISLFDPNVQDEDLEMTCASDGIINESGCLPDIELPRYLQTPYKVPALFPFSRT
TVYVLLSDSKSNRQLKSVVLTGTSDQGPLRLEIPVTKTVEKGSTLHQLAARKAMQELEDDRGWPTQARDGDGKLL
SKEFPGHTANDVEGFEGVFNIHGYEFWRHGYWL*
Coding >Hirsu2|6807
ATGGCCGGGTTTGCCTCGTTCCACTCTCCCCCTCTGGCGCTGCCTCAATGCGGTTGCTTCACCATCGTCGGGGAC
CAGCGCAAGTGCCTCCCCTTGCTCGACGTCCATGTCCACACCTCTATTCTCTCTTCTGCATCCCGCACGACGTTG
AGACAGGCCTTCGTCAACCCAGACGCCCAAGCGCAGCTCGGCGAGGTTCGCTACGATTTCCCCCTCTACGATGGG
GTCTCCGTCGTCGGCTTCAAGTGCTCGATCGGCCGTCGAGTCATCACGGGTGTTATCAAGGAGCGCCAGGAGGCC
AAGAAGGCCTACGAATCAGCCATCAACGAGGGCAAGGTAGCTGCGTTGCTAAACCAAGACATCCGTGCTGCCGAC
GTCTTCACAGCTGCCCTGGGCAACGTGCCGGCTGGTGCAAGAGTTGAGGTGGAAATAACGTACCTGGGCGAATTG
GAGCACGACGCCGAGGCCGACTGCCTGCGACTTACCATCCCGACCAGCGTTGCACCCAGGTATGATCGGACCCAA
GTCCTGACCTGGGCTGCCCACGATGCTGCCGGCGGCGTCGCCCAGGAGGTTGGCAACATGTCCATCACCGTTGAC
GTCCAAATGGCTCGGGAGTGCCCCATCGCCAACATCCAGTCTCCGTCGCATCCCATTTCCGTCGGCATTGGCAAG
ACATCAGCCGTTTCGGCATCCGCCGACGAGCCGTCCTCGCCGCAACGGGCGTCTGTCAGCCTTGCGCTCGAGGCT
GCCCAGCTGGACAAGGACTTTGTTCTCATGGTCGCCGCGGCCGGCCTCACCAGCCCCGTCGCTCTGGTCGAGGCC
CACCCCACTATCCCTCATCAACAGGCAGTGATGGCGACATTGGTCCCGAGGTTCAACCTCCCCGCCGGCAAGCCA
GAGATCGTCTTTGTTTGCGACCGGAGCGGCAGCATGGGCATGGGCCAAAAGATTCCCAACCTCGTGGCCGCCTTG
CAAATCTTTCTCAAGTCGCTCCCGGTCGGCGTGAGATTCAATATCTGTAGTTTTGGTTCCCAGCACAAATTCTTG
TGGCAGAAGTCCCAAGCGTACAACCAAGAAACGCTTGACAAGGCAGTCGAGCACGTTCAGTCCTTTGCAGCGAAC
TTTGGGGGAACAGAAATGTACCAGCCCCTGGTGGACACTTTCAACAGGCGATCTGCCGAGACGAACCTCGAAGTC
TTCTTGCTCACGGACGGAGAAGTCTGGGAGCAGACTGAGCTATTCCAGGTGGTTGACGACCACGTTGGCAAAAGC
AACGGGGCCATCCGAATCTTTACCCTGGGAGTCGGCGACCAGGCCAGCTCGGCCCTGGTAAAGGGAGTGGCGAGG
GCCGGCAACGGATTTGCCCAGATGGTCTCTGACCACGAAAGAATGGACAAGAAGATCATCCGGATGCTTAAGGGA
GCACTCACACCGCACATCAAAGACTACGCCTTGGGAATCACATATGAGGGGCCTGGAAGCGACGATGGCGTGGCC
AGCCGAAGGGAAGACCTTGATGACGACTTTGAGATTGTCGGCGACGCTCTGCGCGGCCTGTCTATCAACACGGAG
AAGGGCAGTGGAGAGAAGAGAGAAAATCAGGCTGAGCCGCAAGGCAGCGATCGGCGCAAAGAGCCCATCTCACTT
TTCGACCCGAACGTCCAAGACGAAGACTTGGAAATGACTTGCGCGTCTGACGGCATCATCAACGAATCTGGCTGC
CTTCCAGATATTGAGCTGCCACGCTACCTCCAGACACCCTACAAGGTCCCGGCGCTCTTCCCTTTCAGCCGTACA
ACCGTTTACGTCCTGCTCTCCGACTCGAAGTCTAATCGCCAACTCAAATCTGTCGTCCTCACGGGCACGTCCGAC
CAGGGGCCACTCAGACTGGAGATCCCGGTGACGAAGACTGTCGAGAAAGGGTCCACGCTACACCAGCTAGCTGCC
CGCAAAGCGATGCAGGAGCTGGAAGACGACCGGGGCTGGCCGACCCAGGCCAGAGATGGCGACGGCAAGCTGCTG
AGCAAAGAGTTTCCAGGCCACACCGCAAACGATGTCGAGGGCTTTGAAGGGGTCTTCAATATCCACGGCTACGAG
TTTTGGCGGCATGGATACTGGCTCTAG
Transcript >Hirsu2|6807
ATGGCCGGGTTTGCCTCGTTCCACTCTCCCCCTCTGGCGCTGCCTCAATGCGGTTGCTTCACCATCGTCGGGGAC
CAGCGCAAGTGCCTCCCCTTGCTCGACGTCCATGTCCACACCTCTATTCTCTCTTCTGCATCCCGCACGACGTTG
AGACAGGCCTTCGTCAACCCAGACGCCCAAGCGCAGCTCGGCGAGGTTCGCTACGATTTCCCCCTCTACGATGGG
GTCTCCGTCGTCGGCTTCAAGTGCTCGATCGGCCGTCGAGTCATCACGGGTGTTATCAAGGAGCGCCAGGAGGCC
AAGAAGGCCTACGAATCAGCCATCAACGAGGGCAAGGTAGCTGCGTTGCTAAACCAAGACATCCGTGCTGCCGAC
GTCTTCACAGCTGCCCTGGGCAACGTGCCGGCTGGTGCAAGAGTTGAGGTGGAAATAACGTACCTGGGCGAATTG
GAGCACGACGCCGAGGCCGACTGCCTGCGACTTACCATCCCGACCAGCGTTGCACCCAGGTATGATCGGACCCAA
GTCCTGACCTGGGCTGCCCACGATGCTGCCGGCGGCGTCGCCCAGGAGGTTGGCAACATGTCCATCACCGTTGAC
GTCCAAATGGCTCGGGAGTGCCCCATCGCCAACATCCAGTCTCCGTCGCATCCCATTTCCGTCGGCATTGGCAAG
ACATCAGCCGTTTCGGCATCCGCCGACGAGCCGTCCTCGCCGCAACGGGCGTCTGTCAGCCTTGCGCTCGAGGCT
GCCCAGCTGGACAAGGACTTTGTTCTCATGGTCGCCGCGGCCGGCCTCACCAGCCCCGTCGCTCTGGTCGAGGCC
CACCCCACTATCCCTCATCAACAGGCAGTGATGGCGACATTGGTCCCGAGGTTCAACCTCCCCGCCGGCAAGCCA
GAGATCGTCTTTGTTTGCGACCGGAGCGGCAGCATGGGCATGGGCCAAAAGATTCCCAACCTCGTGGCCGCCTTG
CAAATCTTTCTCAAGTCGCTCCCGGTCGGCGTGAGATTCAATATCTGTAGTTTTGGTTCCCAGCACAAATTCTTG
TGGCAGAAGTCCCAAGCGTACAACCAAGAAACGCTTGACAAGGCAGTCGAGCACGTTCAGTCCTTTGCAGCGAAC
TTTGGGGGAACAGAAATGTACCAGCCCCTGGTGGACACTTTCAACAGGCGATCTGCCGAGACGAACCTCGAAGTC
TTCTTGCTCACGGACGGAGAAGTCTGGGAGCAGACTGAGCTATTCCAGGTGGTTGACGACCACGTTGGCAAAAGC
AACGGGGCCATCCGAATCTTTACCCTGGGAGTCGGCGACCAGGCCAGCTCGGCCCTGGTAAAGGGAGTGGCGAGG
GCCGGCAACGGATTTGCCCAGATGGTCTCTGACCACGAAAGAATGGACAAGAAGATCATCCGGATGCTTAAGGGA
GCACTCACACCGCACATCAAAGACTACGCCTTGGGAATCACATATGAGGGGCCTGGAAGCGACGATGGCGTGGCC
AGCCGAAGGGAAGACCTTGATGACGACTTTGAGATTGTCGGCGACGCTCTGCGCGGCCTGTCTATCAACACGGAG
AAGGGCAGTGGAGAGAAGAGAGAAAATCAGGCTGAGCCGCAAGGCAGCGATCGGCGCAAAGAGCCCATCTCACTT
TTCGACCCGAACGTCCAAGACGAAGACTTGGAAATGACTTGCGCGTCTGACGGCATCATCAACGAATCTGGCTGC
CTTCCAGATATTGAGCTGCCACGCTACCTCCAGACACCCTACAAGGTCCCGGCGCTCTTCCCTTTCAGCCGTACA
ACCGTTTACGTCCTGCTCTCCGACTCGAAGTCTAATCGCCAACTCAAATCTGTCGTCCTCACGGGCACGTCCGAC
CAGGGGCCACTCAGACTGGAGATCCCGGTGACGAAGACTGTCGAGAAAGGGTCCACGCTACACCAGCTAGCTGCC
CGCAAAGCGATGCAGGAGCTGGAAGACGACCGGGGCTGGCCGACCCAGGCCAGAGATGGCGACGGCAAGCTGCTG
AGCAAAGAGTTTCCAGGCCACACCGCAAACGATGTCGAGGGCTTTGAAGGGGTCTTCAATATCCACGGCTACGAG
TTTTGGCGGCATGGATACTGGCTCTAG
Gene >Hirsu2|6807
ATGGCCGGGTTTGCCTCGTTCCACTCTCCCCCTCTGGCGCTGCCTCAATGCGGTTGCTTCACCATCGTCGGGGAC
CAGCGCAAGTGCCTCCCCTTGCTCGACGTCCATGTCCACACCTCTATTCTCTCTTCTGCATCCCGCACGACGTTG
AGACAGGCCTTCGTCAACCCAGACGCCCAAGCGCAGCTCGGCGAGGTTCGCTACGATTTCCCCCTCTACGATGGG
GTCTCCGTCGTCGGCTTCAAGTGCTCGATCGGCCGTCGAGTCATCACGGGTGTTATCAAGGAGCGCCAGGAGGCC
AAGAAGGCCTACGAATCAGCCATCAACGAGGGCAAGGTAGCTGCGTTGCTAAACCAAGACATCCGTGCTGCCGAC
GTCTTCACAGCTGCCCTGGGCAACGTGCCGGCTGGTGCAAGAGTTGAGGTGGAAATAACGTACCTGGGCGAATTG
GAGCACGACGCCGAGGCCGACTGCCTGCGACTTACCATCCCGACCAGCGTTGCACCCAGGTATGATCGGACCCAA
GTCCTGACCTGGGCTGCCCACGATGCTGCCGGCGGCGTCGCCCAGGAGGTTGGCAACATGTCCATCACCGTTGAC
GTCCAAATGGCTCGGGAGTGCCCCATCGCCAACATCCAGTCTCCGTCGCATCCCATTTCCGTCGGCATTGGCAAG
ACATCAGCCGTTTCGGCATCCGCCGACGAGCCGTCCTCGCCGCAACGGGCGTCTGTCAGCCTTGCGCTCGAGGCT
GCCCAGCTGGACAAGGACTTTGTTCTCATGGTCGCCGCGGCCGGCCTCACCAGCCCCGTCGCTCTGGTCGAGGCC
CACCCCACTATCCCTCATCAACAGGCAGTGATGGCGACATTGGTCCCGAGGTTCAACCTCCCCGCCGGCAAGCCA
GAGATCGTCTTTGTTTGCGACCGGAGCGGCAGCATGGGCATGGGCCAAAAGATTCCCAACCTCGTGGCCGCCTTG
CAAATCTTTCTCAAGTCGCTCCCGGTCGGCGTGAGATTCAATATCTGTAGTTTTGGTTCCCAGCACAAATTCTTG
TGGCAGAAGTCCCAAGCGTACAACCAAGAAACGCTTGACAAGGCAGTCGAGCACGTTCAGTCCTTTGCAGCGAAC
TTTGGGGGAACAGAAATGTACCAGCCCCTGGTGGACACTTTCAACAGGCGATCTGCCGAGACGAACCTCGAAGTC
TTCTTGCTCACGGACGGAGAAGTCTGGGAGCAGACTGAGCTATTCCAGGTGGTTGACGACCACGTTGGCAAAAGC
AACGGGGCCATCCGAATCTTTACCCTGGGAGTCGGCGACCAGGCCAGCTCGGCCCTGGTAAAGGGAGTGGCGAGG
GCCGGCAACGGATTTGCCCAGATGGTCTCTGACCACGAAAGAATGGACAAGAAGATCATCCGGATGCTTAAGGGA
GCACTCACACCGCACATCAAAGACTACGCCTTGGGAATCACATATGAGGGGCCTGGAAGCGACGATGGCGTGGCC
AGCCGAAGGGAAGACCTTGATGACGACTTTGAGATTGTCGGCGACGCTCTGCGCGGCCTGTCTATCAACACGGAG
AAGGGCAGTGGAGAGAAGAGAGAAAATCAGGCTGAGCCGCAAGGCAGCGATCGGCGCAAAGAGCCCATCTCACTT
TTCGACCCGAACGTCCAAGACGAAGACTTGGAAATGACTTGCGCGTCTGACGGCATCATCAACGAATCTGGCTGC
CTTCCAGATATTGAGCTGCCACGCTACCTCCAGACACCCTACAAGGTCCCGGCGCTCTTCCCTTTCAGCCGTACA
ACCGTTTACGTCCTGCTCTCCGACTCGAAGTCTAATCGCCAACTCAAATCTGTCGTCCTCACGGGCACGTCCGAC
CAGGGGCCACTCAGACTGGAGATCCCGGTGACGAAGACTGTCGAGAAAGGGTCCACGCTACACCAGCTAGCTGCC
CGCAAAGCGATGCAGGAGCTGGAAGACGACCGGGGCTGGCCGACCCAGGCCAGAGATGGCGACGGCAAGCTGCTG
AGCAAAGAGTTTCCAGGCCAGTTCGGGAAGATGGCCCGTCGAGAGGCAATCAGGCTTGGCGTAACGTATCAAGTG
AGCGGGAAGTGGTGTTCGTTTGTCGCGGTCCAGGAAGACGGCCAGGGCGACACCGAGGGGAGTAAAGACGAGACT
CTGGGTGAGTTTGAGATCATTGGGCATGAAGAGGCTCCGGCGTCGAGAATGCTGTTTGGCACCGCAGCACCGCAA
ACGATGTCGAGGGCTTTGAAGGGGTCTTCAATATCCACGGCTACGAGTTTTGGCGGCATGGATACTGGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail