Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6804
Gene name
LocationContig_365:1295..2735
Strand-
Gene length (bp)1440
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08031 BBE Berberine and berberine like 3.7E-11 321 360
PF01565 FAD_binding_4 FAD binding domain 3.5E-06 10 56

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 7 367 1.0E-36
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 7 380 1.0E-25
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 3 88 3.0E-11
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 18 81 4.0E-07
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 16 98 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 7 367 1.0E-36
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 7 380 1.0E-25
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 3 88 3.0E-11
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 18 81 4.0E-07
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 16 98 8.0E-07
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 18 143 1.0E-06
sp|Q4ADV8|CKX2_ORYSJ Cytokinin dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CKX2 PE=2 SV=1 18 84 2.0E-06
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 28 87 5.0E-06
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 16 81 5.0E-06
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 13 101 7.0E-06
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 16 81 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6804
MNRYNQTIVGGAGKTVGVTGYMSGGGHSVLSPRFGLAADNVLELDVVTAAGEFLTVNEDRHPDLFWAMRGGGGST
FGVITKVTMWTHDTSEITSVRWMAVMDKAEPGLYDLAADVVSKLPQIVDSGASGWNFVSENIANPIPEPGRNVSQ
KLAGVFGVNMIQDSRDPRIAQRIFKPIEDVIQKKWPGRARLVLQTKQYPSFLAWITDNFDASSAGNSSWAVSRLL
DKKSLTQDTKALGEALQAAGKPSGIVYVFTVTGKGVHNARPRGGGNSVHPAWRSAYVHALTVASFPPFNKAAEKQ
TAERLDASFQPLRDLTPQSGAYVNEALPFEKDWQHTLWSSNYEKLVKIKRAVDPDDLFWCSPCVGNEGWRERQNG
RLCRSR*
Coding >Hirsu2|6804
ATGAACCGATACAACCAGACAATTGTCGGTGGTGCCGGAAAGACCGTAGGCGTCACCGGATACATGTCGGGCGGC
GGCCATTCGGTGTTATCGCCACGTTTCGGGCTGGCCGCGGACAATGTCCTGGAGTTGGACGTTGTTACAGCGGCC
GGCGAGTTCTTGACCGTTAACGAAGATCGCCATCCCGATCTTTTCTGGGCCATGAGAGGCGGCGGAGGCTCCACG
TTCGGTGTCATCACGAAGGTGACCATGTGGACGCATGACACGTCAGAGATTACGAGCGTCCGGTGGATGGCAGTG
ATGGATAAGGCAGAGCCTGGACTGTACGACTTAGCTGCCGACGTCGTCTCCAAACTCCCCCAGATCGTGGACTCG
GGGGCGTCTGGCTGGAATTTCGTGAGCGAAAACATCGCCAACCCGATTCCCGAGCCTGGTCGCAACGTATCGCAG
AAGCTCGCCGGAGTGTTCGGAGTGAACATGATACAAGATTCTCGCGACCCCAGGATTGCGCAGAGGATCTTCAAG
CCCATTGAAGACGTCATTCAAAAAAAGTGGCCCGGCAGGGCAAGACTGGTGCTCCAGACGAAACAGTATCCGTCC
TTCCTTGCCTGGATCACGGATAACTTCGACGCCAGCTCTGCCGGGAACAGCTCGTGGGCCGTATCGCGACTCCTG
GACAAAAAGTCCCTGACGCAGGATACAAAGGCCCTGGGCGAGGCTCTCCAGGCAGCCGGAAAACCTAGCGGTATC
GTGTACGTCTTCACCGTCACGGGCAAGGGTGTCCACAACGCAAGGCCGCGAGGAGGGGGAAATTCTGTCCACCCA
GCCTGGCGCAGCGCTTACGTGCACGCTCTGACCGTCGCTTCATTCCCGCCATTCAACAAGGCCGCAGAGAAGCAA
ACCGCGGAGCGCCTCGACGCGTCTTTCCAGCCTCTGCGGGATTTGACTCCCCAATCCGGAGCGTACGTCAACGAG
GCGCTTCCGTTCGAAAAGGACTGGCAGCACACGCTGTGGTCTTCGAATTACGAGAAACTCGTGAAAATTAAGCGC
GCCGTCGACCCAGATGACCTGTTCTGGTGCTCACCCTGCGTCGGAAACGAAGGTTGGCGGGAGCGCCAGAACGGA
CGTCTCTGCCGGAGTAGGTGA
Transcript >Hirsu2|6804
ATGAACCGATACAACCAGACAATTGTCGGTGGTGCCGGAAAGACCGTAGGCGTCACCGGATACATGTCGGGCGGC
GGCCATTCGGTGTTATCGCCACGTTTCGGGCTGGCCGCGGACAATGTCCTGGAGTTGGACGTTGTTACAGCGGCC
GGCGAGTTCTTGACCGTTAACGAAGATCGCCATCCCGATCTTTTCTGGGCCATGAGAGGCGGCGGAGGCTCCACG
TTCGGTGTCATCACGAAGGTGACCATGTGGACGCATGACACGTCAGAGATTACGAGCGTCCGGTGGATGGCAGTG
ATGGATAAGGCAGAGCCTGGACTGTACGACTTAGCTGCCGACGTCGTCTCCAAACTCCCCCAGATCGTGGACTCG
GGGGCGTCTGGCTGGAATTTCGTGAGCGAAAACATCGCCAACCCGATTCCCGAGCCTGGTCGCAACGTATCGCAG
AAGCTCGCCGGAGTGTTCGGAGTGAACATGATACAAGATTCTCGCGACCCCAGGATTGCGCAGAGGATCTTCAAG
CCCATTGAAGACGTCATTCAAAAAAAGTGGCCCGGCAGGGCAAGACTGGTGCTCCAGACGAAACAGTATCCGTCC
TTCCTTGCCTGGATCACGGATAACTTCGACGCCAGCTCTGCCGGGAACAGCTCGTGGGCCGTATCGCGACTCCTG
GACAAAAAGTCCCTGACGCAGGATACAAAGGCCCTGGGCGAGGCTCTCCAGGCAGCCGGAAAACCTAGCGGTATC
GTGTACGTCTTCACCGTCACGGGCAAGGGTGTCCACAACGCAAGGCCGCGAGGAGGGGGAAATTCTGTCCACCCA
GCCTGGCGCAGCGCTTACGTGCACGCTCTGACCGTCGCTTCATTCCCGCCATTCAACAAGGCCGCAGAGAAGCAA
ACCGCGGAGCGCCTCGACGCGTCTTTCCAGCCTCTGCGGGATTTGACTCCCCAATCCGGAGCGTACGTCAACGAG
GCGCTTCCGTTCGAAAAGGACTGGCAGCACACGCTGTGGTCTTCGAATTACGAGAAACTCGTGAAAATTAAGCGC
GCCGTCGACCCAGATGACCTGTTCTGGTGCTCACCCTGCGTCGGAAACGAAGGTTGGCGGGAGCGCCAGAACGGA
CGTCTCTGCCGGAGTAGGTGA
Gene >Hirsu2|6804
ATGAACCGATACAACCAGACAATTGTCGGTGGTGCCGGAAAGACCGTAGGCGTCACCGGATACATGTCGGGCGGC
GGCCATTCGGTGTTATCGCCACGTTTCGGGCTGGCCGCGGACAATGTCCTGGAGTTGGACGTTGTTACAGCGGCC
GGCGAGTTCTTGACCGTTAACGAAGATCGCCATCCCGATCTTTTCTGGGCCATGAGAGGCGTGAGTTGCCCGATA
GGTCGGAGAGCCGTATGGCCGTTTCTCAAAAGACGCAGACACTGACTGCGGCCACTCACATCGATTATTGCAGGG
CGGAGGCTCCACGTTCGGTGTCATCACGAAGGTGACCATGTGGACGCATGACACGTCAGAGATTACGAGCGTCCG
GTGGATGGCAGTGATGGATAAGGCAGAGCCTGGACTGTACGACTTAGCTGCCGACGTCGTCTCCAAACTCCCCCA
GATCGTGGACTCGGGGGCGTCTGGCTGGAATTTCGTGAGCGAAAACATCGCCAACCCGATTCCCGAGCCTGGTCG
CAACGTATCGCAGAAGCTCGCCGGAGTGTTCGGAGTGAACATGATACAAGATTCTCGCGACCCCAGGATTGCGCA
GAGGATCTTCAAGCCCATTGAAGACGTCATTCAAAAAAAGTGGCCCGGCAGGGCAAGACTGGTGCTCCAGACGAA
ACAGTATCCGTCCTTCCTTGCCTGGATCACGGATAACTTCGACGCCAGCTCTGCCGGGAACAGCTCGTGGGCCGT
ATCGCGACTCCTGGACAAAAAGTCCCTGACGCAGGATACAAAGGCCCTGGGCGAGGCTCTCCAGGCAGCCGGAAA
ACCTAGCGGTATCGTGTACGTCTTCACCGTCACGGGCAAGGGTGTCCACAACGCAAGGCCGCGAGGAGGGGGAAA
TTCTGTCCACCCAGCCTGGCGCAGCGCTTACGTGCACGCTCGTAAGTTGACATCACAGACGCATCACGACCGGCC
TTCCGTGGCTGAATAAGGCGCGTATTTACCGCTAATACTGACGATGAAAGTGACCGTCGCTTCATTCCCGCCATT
CAACAAGGCCGCAGAGAAGCAAACCGCGGAGCGCCTCGACGCGTCTTTCCAGCCTCTGCGGGATTTGACTCCCCA
ATCCGGAGCGTACGTCAACGAGGTAGGTGCACTATGTCCACATATACTGTTCTGAACGCTTCCTTAGTTAAGATG
TGATTTATTTCTCCTTTGGCTTTTACTCGGGACATGCCCCTTGCTGACTGGACTCTGTGAACGACACAGGCGCTT
CCGTTCGAAAAGGACTGGCAGCACACGCTGTGGTCTTCGAATTACGAGAAACTCGTGAAAATTAAGCGCGCCGTC
GACCCAGATGACCTGTTCTGGTGCTCACCCTGCGTCGGAAACGAAGGTTGGCGGGAGCGCCAGAACGGACGTCTC
TGCCGGAGTAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail