Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6804
Gene name
LocationContig_365:1295..2735
Strand-
Gene length (bp)1440
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08031 BBE Berberine and berberine like 4.1E-11 321 360
PF01565 FAD_binding_4 FAD binding domain 3.5E-06 10 56

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 7 367 1.0E-36
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 7 380 1.0E-25
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 3 88 3.0E-11
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 18 81 4.0E-07
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 16 98 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 7 367 1.0E-36
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 7 380 1.0E-25
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 3 88 3.0E-11
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 18 81 4.0E-07
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 16 98 8.0E-07
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 18 143 1.0E-06
sp|Q4ADV8|CKX2_ORYSJ Cytokinin dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CKX2 PE=2 SV=1 18 84 2.0E-06
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 28 87 5.0E-06
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 16 81 5.0E-06
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 13 101 7.0E-06
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 16 81 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Peroxisomal targeting signal 0.4186 0.1651 0.5908 0.1412 0.2545 0.0315 0.0296 0.2039 0.0241 0.738

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 1.4E-41 4 358

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup133
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7793
Ophiocordyceps australis map64 (Brazil) OphauB2|5097
Ophiocordyceps camponoti-floridani Ophcf2|00778
Ophiocordyceps camponoti-floridani Ophcf2|03867
Ophiocordyceps camponoti-rufipedis Ophun1|5948
Ophiocordyceps camponoti-rufipedis Ophun1|6363
Ophiocordyceps kimflemingae Ophio5|1641
Ophiocordyceps kimflemingae Ophio5|2605
Ophiocordyceps kimflemingae Ophio5|3904
Ophiocordyceps subramaniannii Hirsu2|10680
Ophiocordyceps subramaniannii Hirsu2|1755
Ophiocordyceps subramaniannii Hirsu2|6804 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9391

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6804
MNRYNQTIVGGAGKTVGVTGYMSGGGHSVLSPRFGLAADNVLELDVVTAAGEFLTVNEDRHPDLFWAMRGGGGST
FGVITKVTMWTHDTSEITSVRWMAVMDKAEPGLYDLAADVVSKLPQIVDSGASGWNFVSENIANPIPEPGRNVSQ
KLAGVFGVNMIQDSRDPRIAQRIFKPIEDVIQKKWPGRARLVLQTKQYPSFLAWITDNFDASSAGNSSWAVSRLL
DKKSLTQDTKALGEALQAAGKPSGIVYVFTVTGKGVHNARPRGGGNSVHPAWRSAYVHALTVASFPPFNKAAEKQ
TAERLDASFQPLRDLTPQSGAYVNEALPFEKDWQHTLWSSNYEKLVKIKRAVDPDDLFWCSPCVGNEGWRERQNG
RLCRSR*
Coding >Hirsu2|6804
ATGAACCGATACAACCAGACAATTGTCGGTGGTGCCGGAAAGACCGTAGGCGTCACCGGATACATGTCGGGCGGC
GGCCATTCGGTGTTATCGCCACGTTTCGGGCTGGCCGCGGACAATGTCCTGGAGTTGGACGTTGTTACAGCGGCC
GGCGAGTTCTTGACCGTTAACGAAGATCGCCATCCCGATCTTTTCTGGGCCATGAGAGGCGGCGGAGGCTCCACG
TTCGGTGTCATCACGAAGGTGACCATGTGGACGCATGACACGTCAGAGATTACGAGCGTCCGGTGGATGGCAGTG
ATGGATAAGGCAGAGCCTGGACTGTACGACTTAGCTGCCGACGTCGTCTCCAAACTCCCCCAGATCGTGGACTCG
GGGGCGTCTGGCTGGAATTTCGTGAGCGAAAACATCGCCAACCCGATTCCCGAGCCTGGTCGCAACGTATCGCAG
AAGCTCGCCGGAGTGTTCGGAGTGAACATGATACAAGATTCTCGCGACCCCAGGATTGCGCAGAGGATCTTCAAG
CCCATTGAAGACGTCATTCAAAAAAAGTGGCCCGGCAGGGCAAGACTGGTGCTCCAGACGAAACAGTATCCGTCC
TTCCTTGCCTGGATCACGGATAACTTCGACGCCAGCTCTGCCGGGAACAGCTCGTGGGCCGTATCGCGACTCCTG
GACAAAAAGTCCCTGACGCAGGATACAAAGGCCCTGGGCGAGGCTCTCCAGGCAGCCGGAAAACCTAGCGGTATC
GTGTACGTCTTCACCGTCACGGGCAAGGGTGTCCACAACGCAAGGCCGCGAGGAGGGGGAAATTCTGTCCACCCA
GCCTGGCGCAGCGCTTACGTGCACGCTCTGACCGTCGCTTCATTCCCGCCATTCAACAAGGCCGCAGAGAAGCAA
ACCGCGGAGCGCCTCGACGCGTCTTTCCAGCCTCTGCGGGATTTGACTCCCCAATCCGGAGCGTACGTCAACGAG
GCGCTTCCGTTCGAAAAGGACTGGCAGCACACGCTGTGGTCTTCGAATTACGAGAAACTCGTGAAAATTAAGCGC
GCCGTCGACCCAGATGACCTGTTCTGGTGCTCACCCTGCGTCGGAAACGAAGGTTGGCGGGAGCGCCAGAACGGA
CGTCTCTGCCGGAGTAGGTGA
Transcript >Hirsu2|6804
ATGAACCGATACAACCAGACAATTGTCGGTGGTGCCGGAAAGACCGTAGGCGTCACCGGATACATGTCGGGCGGC
GGCCATTCGGTGTTATCGCCACGTTTCGGGCTGGCCGCGGACAATGTCCTGGAGTTGGACGTTGTTACAGCGGCC
GGCGAGTTCTTGACCGTTAACGAAGATCGCCATCCCGATCTTTTCTGGGCCATGAGAGGCGGCGGAGGCTCCACG
TTCGGTGTCATCACGAAGGTGACCATGTGGACGCATGACACGTCAGAGATTACGAGCGTCCGGTGGATGGCAGTG
ATGGATAAGGCAGAGCCTGGACTGTACGACTTAGCTGCCGACGTCGTCTCCAAACTCCCCCAGATCGTGGACTCG
GGGGCGTCTGGCTGGAATTTCGTGAGCGAAAACATCGCCAACCCGATTCCCGAGCCTGGTCGCAACGTATCGCAG
AAGCTCGCCGGAGTGTTCGGAGTGAACATGATACAAGATTCTCGCGACCCCAGGATTGCGCAGAGGATCTTCAAG
CCCATTGAAGACGTCATTCAAAAAAAGTGGCCCGGCAGGGCAAGACTGGTGCTCCAGACGAAACAGTATCCGTCC
TTCCTTGCCTGGATCACGGATAACTTCGACGCCAGCTCTGCCGGGAACAGCTCGTGGGCCGTATCGCGACTCCTG
GACAAAAAGTCCCTGACGCAGGATACAAAGGCCCTGGGCGAGGCTCTCCAGGCAGCCGGAAAACCTAGCGGTATC
GTGTACGTCTTCACCGTCACGGGCAAGGGTGTCCACAACGCAAGGCCGCGAGGAGGGGGAAATTCTGTCCACCCA
GCCTGGCGCAGCGCTTACGTGCACGCTCTGACCGTCGCTTCATTCCCGCCATTCAACAAGGCCGCAGAGAAGCAA
ACCGCGGAGCGCCTCGACGCGTCTTTCCAGCCTCTGCGGGATTTGACTCCCCAATCCGGAGCGTACGTCAACGAG
GCGCTTCCGTTCGAAAAGGACTGGCAGCACACGCTGTGGTCTTCGAATTACGAGAAACTCGTGAAAATTAAGCGC
GCCGTCGACCCAGATGACCTGTTCTGGTGCTCACCCTGCGTCGGAAACGAAGGTTGGCGGGAGCGCCAGAACGGA
CGTCTCTGCCGGAGTAGGTGA
Gene >Hirsu2|6804
ATGAACCGATACAACCAGACAATTGTCGGTGGTGCCGGAAAGACCGTAGGCGTCACCGGATACATGTCGGGCGGC
GGCCATTCGGTGTTATCGCCACGTTTCGGGCTGGCCGCGGACAATGTCCTGGAGTTGGACGTTGTTACAGCGGCC
GGCGAGTTCTTGACCGTTAACGAAGATCGCCATCCCGATCTTTTCTGGGCCATGAGAGGCGTGAGTTGCCCGATA
GGTCGGAGAGCCGTATGGCCGTTTCTCAAAAGACGCAGACACTGACTGCGGCCACTCACATCGATTATTGCAGGG
CGGAGGCTCCACGTTCGGTGTCATCACGAAGGTGACCATGTGGACGCATGACACGTCAGAGATTACGAGCGTCCG
GTGGATGGCAGTGATGGATAAGGCAGAGCCTGGACTGTACGACTTAGCTGCCGACGTCGTCTCCAAACTCCCCCA
GATCGTGGACTCGGGGGCGTCTGGCTGGAATTTCGTGAGCGAAAACATCGCCAACCCGATTCCCGAGCCTGGTCG
CAACGTATCGCAGAAGCTCGCCGGAGTGTTCGGAGTGAACATGATACAAGATTCTCGCGACCCCAGGATTGCGCA
GAGGATCTTCAAGCCCATTGAAGACGTCATTCAAAAAAAGTGGCCCGGCAGGGCAAGACTGGTGCTCCAGACGAA
ACAGTATCCGTCCTTCCTTGCCTGGATCACGGATAACTTCGACGCCAGCTCTGCCGGGAACAGCTCGTGGGCCGT
ATCGCGACTCCTGGACAAAAAGTCCCTGACGCAGGATACAAAGGCCCTGGGCGAGGCTCTCCAGGCAGCCGGAAA
ACCTAGCGGTATCGTGTACGTCTTCACCGTCACGGGCAAGGGTGTCCACAACGCAAGGCCGCGAGGAGGGGGAAA
TTCTGTCCACCCAGCCTGGCGCAGCGCTTACGTGCACGCTCGTAAGTTGACATCACAGACGCATCACGACCGGCC
TTCCGTGGCTGAATAAGGCGCGTATTTACCGCTAATACTGACGATGAAAGTGACCGTCGCTTCATTCCCGCCATT
CAACAAGGCCGCAGAGAAGCAAACCGCGGAGCGCCTCGACGCGTCTTTCCAGCCTCTGCGGGATTTGACTCCCCA
ATCCGGAGCGTACGTCAACGAGGTAGGTGCACTATGTCCACATATACTGTTCTGAACGCTTCCTTAGTTAAGATG
TGATTTATTTCTCCTTTGGCTTTTACTCGGGACATGCCCCTTGCTGACTGGACTCTGTGAACGACACAGGCGCTT
CCGTTCGAAAAGGACTGGCAGCACACGCTGTGGTCTTCGAATTACGAGAAACTCGTGAAAATTAAGCGCGCCGTC
GACCCAGATGACCTGTTCTGGTGCTCACCCTGCGTCGGAAACGAAGGTTGGCGGGAGCGCCAGAACGGACGTCTC
TGCCGGAGTAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail