Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6802
Gene name
LocationContig_364:15396..18906
Strand-
Gene length (bp)3510
Transcript length (bp)3510
Coding sequence length (bp)3510
Protein length (aa) 1170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 7.6E-16 496 566
PF07529 HSA HSA domain 4.6E-14 222 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBU6|EAF1_NEUCR Chromatin modification-related protein eaf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eaf-1 PE=3 SV=1 25 818 0.0E+00
sp|Q4IB96|AEF1_GIBZE Chromatin modification-related protein EAF1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EAF1 PE=3 SV=1 1 1006 0.0E+00
sp|Q4WP03|EAF1_ASPFU Chromatin modification-related protein eaf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eaf1 PE=3 SV=1 45 969 1.0E-160
sp|Q5B4Q8|EAF1_EMENI Chromatin modification-related protein eaf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eaf1 PE=3 SV=1 49 989 2.0E-156
sp|Q756L0|EAF1_ASHGO Chromatin modification-related protein EAF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EAF1 PE=3 SV=2 170 696 3.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBU6|EAF1_NEUCR Chromatin modification-related protein eaf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eaf-1 PE=3 SV=1 25 818 0.0E+00
sp|Q4IB96|AEF1_GIBZE Chromatin modification-related protein EAF1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EAF1 PE=3 SV=1 1 1006 0.0E+00
sp|Q4WP03|EAF1_ASPFU Chromatin modification-related protein eaf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eaf1 PE=3 SV=1 45 969 1.0E-160
sp|Q5B4Q8|EAF1_EMENI Chromatin modification-related protein eaf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eaf1 PE=3 SV=1 49 989 2.0E-156
sp|Q756L0|EAF1_ASHGO Chromatin modification-related protein EAF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EAF1 PE=3 SV=2 170 696 3.0E-25
sp|O59773|EAF_SCHPO Chromatin modification-related protein vid21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vid21 PE=1 SV=2 168 706 4.0E-20
sp|Q4P209|EAF11_USTMA Chromatin modification-related protein EAF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EAF1 PE=3 SV=1 174 279 1.0E-19
sp|Q6C7K8|EAF1_YARLI Chromatin modification-related protein EAF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EAF1 PE=3 SV=1 144 307 3.0E-19
sp|P0CO99|EAF1_CRYNB Chromatin modification-related protein EAF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EAF1 PE=3 SV=1 197 278 3.0E-19
sp|P0CO98|EAF1_CRYNJ Chromatin modification-related protein EAF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EAF1 PE=3 SV=1 197 278 3.0E-19
sp|Q6CMB8|EAF1_KLULA Chromatin modification-related protein EAF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EAF1 PE=3 SV=1 429 716 1.0E-16
sp|Q6C7K8|EAF1_YARLI Chromatin modification-related protein EAF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EAF1 PE=3 SV=1 481 679 3.0E-15
sp|Q5A119|EAF1_CANAL Chromatin modification-related protein EAF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAF1 PE=3 SV=1 489 675 8.0E-14
sp|Q6BI82|EAF1_DEBHA Chromatin modification-related protein EAF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EAF1 PE=3 SV=2 489 675 8.0E-14
sp|Q6CMB8|EAF1_KLULA Chromatin modification-related protein EAF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EAF1 PE=3 SV=1 170 299 2.0E-12
sp|Q06337|EAF1_YEAST Chromatin modification-related protein EAF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EAF1 PE=1 SV=2 471 673 2.0E-12
sp|Q6BI82|EAF1_DEBHA Chromatin modification-related protein EAF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EAF1 PE=3 SV=2 170 269 7.0E-11
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 202 267 1.0E-10
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 202 267 4.0E-10
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 199 264 2.0E-09
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 199 267 5.0E-09
sp|Q06337|EAF1_YEAST Chromatin modification-related protein EAF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EAF1 PE=1 SV=2 139 328 1.0E-08
sp|Q5A119|EAF1_CANAL Chromatin modification-related protein EAF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAF1 PE=3 SV=1 173 268 4.0E-07
sp|Q4P209|EAF11_USTMA Chromatin modification-related protein EAF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EAF1 PE=3 SV=1 359 672 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6802
MDVDSLKVKPEMEEQSVLSSRDTNLPARDAPPACPTTKLPAREQPSAPERAVTRVSSGAMRLKSVNEIVGGLPRL
PTGSSRDSTAKGTHDQLTPVTSTPQSPASRVRNTGTTKRDKFKSHASTVLFGKQPKRVEDRALVPGLKETIQASD
DYYTTLFVQNFTGSSKWMQPLERILFQANKTISSPDAHLVIQDHQACRVLRRVYHLQQNDKWSLRQPKRCPEPVR
LASHWDSMLQEMRWMRTDFREERKWKMAVARKMAHACAEWYEAGPEERKCLQVEATRPPTARPVERGADTIDMAD
DGIENQPTPDLVPSGDADSPQNVDDLVEDFAETVAPSAIFALQEDEVVFGLRRTAASDQLLEELPMYGLPLKAHK
SDVISPDFDPDAHWRRPALPLSKYVEGEMKLVSNRPPQKRGRYYYENEEDEDEDEDRDGQFVRDQLVHNMRLPPS
TDEVSLFHPESKHIRDRLHAGHQFRPPSEHPMPTQSFYESRSPSQWTLAEDDELRGLVREYSYNWSLISSILSTK
SSFAAGAERRTPWECFERWINLEGLPADMQKTQYFKAYNSRIEAAQKVIAQQNQLAAQQASAAGAAVTPMRRRPS
LPLRVEKRRNQKHFTMLDAMRKLAKKRETAIQKQQHSASQNAANKKTNEAISQRPAKTPRDYSLMRWERDQALAE
KMAQYAQRQEAQRRAAMQARVQAQAAQAAGAAAANMPAQNGGHLAANPSMNGAGRPMSSHLAAAASQNRPRMPMQ
APQANGVGIGGVQAQMNGGLSAPPQMNGSPQTQVPGAQAQHRMPMPNQQPDASLMLRAQRISEQQRAAVQIQQQQ
QVQQQHQQQVQQQVPQQQQQQPPPQQPQQLGNPGTPGATTSQHNSPSMRNGVNGISQQSFMSNPQAMMASYAAAA
TANGNGLGVSQANGVHLPAAANGSSPGQRTHTQLPPGIAAQLNHLETSFRAKNPNLTPEQARQLATEHLTRAMMA
QRQNAMNAAAGASGQTSIANSMAATTSPHQYAALLRQQQQAQQAQQAQQQQQAQPHKAQHHQAQQQQHQAQAQQA
QQAQQQQHHGQQQQSQPRPAQQLQQQHQHHVQSQQHQQAQQQHHQLLQQQQQRQPPKPQPPQQQPLQQQPQPQYQ
QHAGTKQGTPVPAPAATPAAASASPAQSHQRTSSGSATPSALGK*
Coding >Hirsu2|6802
ATGGACGTAGATTCTCTCAAGGTCAAGCCCGAGATGGAGGAGCAATCGGTCCTGTCGTCACGAGACACTAATCTT
CCGGCCCGCGATGCGCCTCCAGCCTGCCCCACGACCAAGCTACCGGCCAGGGAACAGCCGTCGGCCCCTGAGCGG
GCCGTAACCCGAGTCTCGTCAGGTGCCATGCGCCTCAAGTCTGTCAACGAGATCGTGGGCGGCCTGCCACGGCTT
CCCACCGGCTCGAGTCGAGACTCGACCGCCAAAGGGACGCACGATCAACTCACGCCCGTCACGTCGACGCCCCAG
TCCCCGGCCTCTCGAGTCAGAAACACGGGCACGACAAAGAGGGACAAGTTCAAAAGCCATGCGTCGACGGTTCTC
TTTGGCAAGCAACCGAAACGAGTCGAAGACAGGGCATTGGTCCCTGGCCTCAAGGAGACAATTCAAGCGTCCGAC
GACTACTACACCACGCTCTTCGTGCAGAATTTCACCGGATCCTCCAAATGGATGCAACCGTTGGAACGGATTCTC
TTCCAGGCTAACAAGACGATTTCCAGCCCCGACGCTCACCTCGTCATACAGGACCACCAGGCTTGTAGGGTGCTC
AGGCGGGTATATCACCTTCAGCAGAATGACAAGTGGTCTTTGCGGCAGCCAAAGCGCTGCCCGGAGCCTGTACGA
CTTGCCTCCCATTGGGACTCGATGCTGCAGGAGATGAGGTGGATGCGGACAGACTTCCGAGAGGAACGGAAATGG
AAGATGGCCGTCGCGCGCAAGATGGCTCATGCCTGCGCGGAATGGTACGAGGCCGGCCCCGAGGAGCGCAAGTGC
CTTCAAGTCGAGGCGACCCGGCCGCCAACGGCGCGGCCCGTGGAGCGAGGCGCGGACACGATCGACATGGCCGAC
GACGGCATAGAGAACCAGCCAACCCCGGACCTCGTGCCCTCGGGAGACGCCGACTCGCCCCAAAATGTGGACGAT
CTCGTCGAAGATTTTGCCGAGACGGTGGCGCCATCGGCAATCTTCGCTCTGCAAGAAGACGAGGTCGTGTTCGGG
CTGCGCAGGACGGCGGCTTCGGACCAACTGCTGGAGGAGCTGCCCATGTACGGGCTGCCGCTCAAGGCACACAAA
TCCGACGTCATTAGCCCCGACTTCGATCCGGATGCACACTGGCGCCGTCCCGCCTTGCCCTTGAGCAAGTACGTC
GAGGGAGAGATGAAGCTCGTGTCGAATCGCCCTCCGCAGAAGCGCGGTCGGTATTATTATGAGAACGAGGAGGAC
GAGGACGAGGACGAGGACAGGGACGGCCAGTTCGTGCGCGACCAGCTCGTTCACAACATGCGGCTGCCCCCCAGC
ACGGACGAGGTCTCGTTGTTTCACCCCGAGTCGAAGCACATACGCGATCGCCTGCACGCCGGCCACCAGTTCCGG
CCACCGTCCGAGCATCCCATGCCGACCCAAAGCTTCTACGAATCCCGCAGCCCCTCCCAATGGACCCTGGCCGAG
GACGATGAGCTCCGCGGGCTTGTGCGGGAGTACTCGTACAACTGGTCTCTCATCTCGAGCATACTGTCGACGAAG
TCTTCCTTCGCGGCCGGGGCGGAGAGGCGGACGCCTTGGGAATGTTTTGAGCGCTGGATCAATCTCGAGGGCCTG
CCAGCGGACATGCAGAAGACGCAGTACTTCAAGGCTTACAACAGCAGGATCGAGGCTGCTCAGAAGGTCATTGCA
CAGCAGAATCAGCTGGCTGCGCAACAGGCTTCGGCAGCCGGAGCCGCCGTGACGCCCATGCGGCGACGACCTTCC
CTGCCTCTGAGGGTGGAGAAACGCCGCAACCAGAAGCATTTCACGATGCTGGATGCCATGAGGAAGCTCGCCAAG
AAGAGGGAGACGGCAATCCAGAAGCAGCAGCATTCGGCGTCGCAGAACGCTGCCAACAAGAAGACCAACGAGGCC
ATCTCCCAGAGGCCGGCCAAGACGCCGAGAGACTACAGCCTCATGCGCTGGGAAAGAGACCAAGCTCTGGCGGAG
AAGATGGCCCAGTACGCACAGCGTCAGGAAGCGCAGCGACGAGCGGCCATGCAGGCCAGAGTGCAGGCCCAGGCC
GCCCAAGCCGCCGGCGCTGCCGCGGCCAACATGCCAGCCCAGAACGGGGGACATCTGGCCGCCAATCCCAGCATG
AATGGAGCCGGTCGTCCCATGTCCAGCCACCTCGCCGCCGCCGCGAGCCAAAATCGGCCACGAATGCCGATGCAA
GCTCCTCAGGCCAACGGCGTCGGCATCGGGGGCGTCCAAGCCCAGATGAACGGCGGCCTGTCGGCCCCTCCGCAG
ATGAACGGCTCTCCGCAGACACAAGTGCCAGGGGCGCAAGCACAGCATAGGATGCCCATGCCGAACCAGCAGCCG
GACGCGAGCTTGATGCTGCGTGCTCAACGCATCTCGGAGCAGCAGCGTGCCGCTGTCCAGATCCAGCAGCAACAG
CAAGTCCAACAACAGCATCAACAGCAGGTCCAGCAGCAAGTCCCGCAGCAGCAGCAGCAGCAGCCGCCGCCGCAG
CAGCCGCAGCAACTGGGCAATCCCGGCACCCCTGGCGCGACGACGAGCCAACACAACTCGCCGTCCATGCGGAAC
GGTGTTAACGGCATCAGCCAGCAGTCGTTCATGAGTAACCCTCAGGCTATGATGGCATCGTATGCCGCCGCCGCC
ACCGCCAACGGCAACGGTCTCGGGGTGTCGCAGGCAAACGGCGTTCACCTTCCGGCCGCAGCCAACGGGTCGTCT
CCCGGACAGCGCACACACACGCAGCTGCCGCCCGGCATCGCCGCACAGCTGAACCACCTGGAGACGAGTTTCAGG
GCTAAGAACCCTAACCTGACGCCCGAGCAGGCACGGCAGCTGGCCACGGAGCATCTCACGCGGGCCATGATGGCC
CAGCGGCAGAATGCCATGAACGCTGCTGCAGGCGCCTCGGGCCAGACTAGCATCGCCAACAGCATGGCTGCGACA
ACGAGCCCGCACCAGTACGCGGCGCTGCTTCGGCAGCAGCAGCAGGCCCAGCAGGCCCAGCAGGCCCAGCAGCAG
CAGCAGGCTCAACCGCACAAGGCCCAACACCATCAGGCCCAGCAGCAGCAGCATCAAGCTCAGGCCCAGCAGGCC
CAGCAGGCCCAGCAGCAGCAGCACCACGGCCAGCAGCAGCAAAGCCAGCCACGCCCGGCTCAGCAACTGCAGCAA
CAACACCAGCATCACGTCCAGTCCCAGCAGCACCAGCAGGCCCAGCAGCAACACCACCAGCTCCTGCAGCAGCAG
CAGCAGCGCCAGCCGCCCAAGCCGCAGCCACCGCAGCAGCAGCCACTTCAACAACAGCCGCAGCCGCAGTACCAG
CAGCACGCGGGCACGAAGCAGGGCACGCCCGTCCCTGCCCCCGCCGCCACGCCGGCAGCGGCGTCCGCCAGCCCC
GCGCAGTCCCACCAGCGCACGTCGAGCGGCAGCGCGACACCGTCGGCGCTGGGAAAATGA
Transcript >Hirsu2|6802
ATGGACGTAGATTCTCTCAAGGTCAAGCCCGAGATGGAGGAGCAATCGGTCCTGTCGTCACGAGACACTAATCTT
CCGGCCCGCGATGCGCCTCCAGCCTGCCCCACGACCAAGCTACCGGCCAGGGAACAGCCGTCGGCCCCTGAGCGG
GCCGTAACCCGAGTCTCGTCAGGTGCCATGCGCCTCAAGTCTGTCAACGAGATCGTGGGCGGCCTGCCACGGCTT
CCCACCGGCTCGAGTCGAGACTCGACCGCCAAAGGGACGCACGATCAACTCACGCCCGTCACGTCGACGCCCCAG
TCCCCGGCCTCTCGAGTCAGAAACACGGGCACGACAAAGAGGGACAAGTTCAAAAGCCATGCGTCGACGGTTCTC
TTTGGCAAGCAACCGAAACGAGTCGAAGACAGGGCATTGGTCCCTGGCCTCAAGGAGACAATTCAAGCGTCCGAC
GACTACTACACCACGCTCTTCGTGCAGAATTTCACCGGATCCTCCAAATGGATGCAACCGTTGGAACGGATTCTC
TTCCAGGCTAACAAGACGATTTCCAGCCCCGACGCTCACCTCGTCATACAGGACCACCAGGCTTGTAGGGTGCTC
AGGCGGGTATATCACCTTCAGCAGAATGACAAGTGGTCTTTGCGGCAGCCAAAGCGCTGCCCGGAGCCTGTACGA
CTTGCCTCCCATTGGGACTCGATGCTGCAGGAGATGAGGTGGATGCGGACAGACTTCCGAGAGGAACGGAAATGG
AAGATGGCCGTCGCGCGCAAGATGGCTCATGCCTGCGCGGAATGGTACGAGGCCGGCCCCGAGGAGCGCAAGTGC
CTTCAAGTCGAGGCGACCCGGCCGCCAACGGCGCGGCCCGTGGAGCGAGGCGCGGACACGATCGACATGGCCGAC
GACGGCATAGAGAACCAGCCAACCCCGGACCTCGTGCCCTCGGGAGACGCCGACTCGCCCCAAAATGTGGACGAT
CTCGTCGAAGATTTTGCCGAGACGGTGGCGCCATCGGCAATCTTCGCTCTGCAAGAAGACGAGGTCGTGTTCGGG
CTGCGCAGGACGGCGGCTTCGGACCAACTGCTGGAGGAGCTGCCCATGTACGGGCTGCCGCTCAAGGCACACAAA
TCCGACGTCATTAGCCCCGACTTCGATCCGGATGCACACTGGCGCCGTCCCGCCTTGCCCTTGAGCAAGTACGTC
GAGGGAGAGATGAAGCTCGTGTCGAATCGCCCTCCGCAGAAGCGCGGTCGGTATTATTATGAGAACGAGGAGGAC
GAGGACGAGGACGAGGACAGGGACGGCCAGTTCGTGCGCGACCAGCTCGTTCACAACATGCGGCTGCCCCCCAGC
ACGGACGAGGTCTCGTTGTTTCACCCCGAGTCGAAGCACATACGCGATCGCCTGCACGCCGGCCACCAGTTCCGG
CCACCGTCCGAGCATCCCATGCCGACCCAAAGCTTCTACGAATCCCGCAGCCCCTCCCAATGGACCCTGGCCGAG
GACGATGAGCTCCGCGGGCTTGTGCGGGAGTACTCGTACAACTGGTCTCTCATCTCGAGCATACTGTCGACGAAG
TCTTCCTTCGCGGCCGGGGCGGAGAGGCGGACGCCTTGGGAATGTTTTGAGCGCTGGATCAATCTCGAGGGCCTG
CCAGCGGACATGCAGAAGACGCAGTACTTCAAGGCTTACAACAGCAGGATCGAGGCTGCTCAGAAGGTCATTGCA
CAGCAGAATCAGCTGGCTGCGCAACAGGCTTCGGCAGCCGGAGCCGCCGTGACGCCCATGCGGCGACGACCTTCC
CTGCCTCTGAGGGTGGAGAAACGCCGCAACCAGAAGCATTTCACGATGCTGGATGCCATGAGGAAGCTCGCCAAG
AAGAGGGAGACGGCAATCCAGAAGCAGCAGCATTCGGCGTCGCAGAACGCTGCCAACAAGAAGACCAACGAGGCC
ATCTCCCAGAGGCCGGCCAAGACGCCGAGAGACTACAGCCTCATGCGCTGGGAAAGAGACCAAGCTCTGGCGGAG
AAGATGGCCCAGTACGCACAGCGTCAGGAAGCGCAGCGACGAGCGGCCATGCAGGCCAGAGTGCAGGCCCAGGCC
GCCCAAGCCGCCGGCGCTGCCGCGGCCAACATGCCAGCCCAGAACGGGGGACATCTGGCCGCCAATCCCAGCATG
AATGGAGCCGGTCGTCCCATGTCCAGCCACCTCGCCGCCGCCGCGAGCCAAAATCGGCCACGAATGCCGATGCAA
GCTCCTCAGGCCAACGGCGTCGGCATCGGGGGCGTCCAAGCCCAGATGAACGGCGGCCTGTCGGCCCCTCCGCAG
ATGAACGGCTCTCCGCAGACACAAGTGCCAGGGGCGCAAGCACAGCATAGGATGCCCATGCCGAACCAGCAGCCG
GACGCGAGCTTGATGCTGCGTGCTCAACGCATCTCGGAGCAGCAGCGTGCCGCTGTCCAGATCCAGCAGCAACAG
CAAGTCCAACAACAGCATCAACAGCAGGTCCAGCAGCAAGTCCCGCAGCAGCAGCAGCAGCAGCCGCCGCCGCAG
CAGCCGCAGCAACTGGGCAATCCCGGCACCCCTGGCGCGACGACGAGCCAACACAACTCGCCGTCCATGCGGAAC
GGTGTTAACGGCATCAGCCAGCAGTCGTTCATGAGTAACCCTCAGGCTATGATGGCATCGTATGCCGCCGCCGCC
ACCGCCAACGGCAACGGTCTCGGGGTGTCGCAGGCAAACGGCGTTCACCTTCCGGCCGCAGCCAACGGGTCGTCT
CCCGGACAGCGCACACACACGCAGCTGCCGCCCGGCATCGCCGCACAGCTGAACCACCTGGAGACGAGTTTCAGG
GCTAAGAACCCTAACCTGACGCCCGAGCAGGCACGGCAGCTGGCCACGGAGCATCTCACGCGGGCCATGATGGCC
CAGCGGCAGAATGCCATGAACGCTGCTGCAGGCGCCTCGGGCCAGACTAGCATCGCCAACAGCATGGCTGCGACA
ACGAGCCCGCACCAGTACGCGGCGCTGCTTCGGCAGCAGCAGCAGGCCCAGCAGGCCCAGCAGGCCCAGCAGCAG
CAGCAGGCTCAACCGCACAAGGCCCAACACCATCAGGCCCAGCAGCAGCAGCATCAAGCTCAGGCCCAGCAGGCC
CAGCAGGCCCAGCAGCAGCAGCACCACGGCCAGCAGCAGCAAAGCCAGCCACGCCCGGCTCAGCAACTGCAGCAA
CAACACCAGCATCACGTCCAGTCCCAGCAGCACCAGCAGGCCCAGCAGCAACACCACCAGCTCCTGCAGCAGCAG
CAGCAGCGCCAGCCGCCCAAGCCGCAGCCACCGCAGCAGCAGCCACTTCAACAACAGCCGCAGCCGCAGTACCAG
CAGCACGCGGGCACGAAGCAGGGCACGCCCGTCCCTGCCCCCGCCGCCACGCCGGCAGCGGCGTCCGCCAGCCCC
GCGCAGTCCCACCAGCGCACGTCGAGCGGCAGCGCGACACCGTCGGCGCTGGGAAAATGA
Gene >Hirsu2|6802
ATGGACGTAGATTCTCTCAAGGTCAAGCCCGAGATGGAGGAGCAATCGGTCCTGTCGTCACGAGACACTAATCTT
CCGGCCCGCGATGCGCCTCCAGCCTGCCCCACGACCAAGCTACCGGCCAGGGAACAGCCGTCGGCCCCTGAGCGG
GCCGTAACCCGAGTCTCGTCAGGTGCCATGCGCCTCAAGTCTGTCAACGAGATCGTGGGCGGCCTGCCACGGCTT
CCCACCGGCTCGAGTCGAGACTCGACCGCCAAAGGGACGCACGATCAACTCACGCCCGTCACGTCGACGCCCCAG
TCCCCGGCCTCTCGAGTCAGAAACACGGGCACGACAAAGAGGGACAAGTTCAAAAGCCATGCGTCGACGGTTCTC
TTTGGCAAGCAACCGAAACGAGTCGAAGACAGGGCATTGGTCCCTGGCCTCAAGGAGACAATTCAAGCGTCCGAC
GACTACTACACCACGCTCTTCGTGCAGAATTTCACCGGATCCTCCAAATGGATGCAACCGTTGGAACGGATTCTC
TTCCAGGCTAACAAGACGATTTCCAGCCCCGACGCTCACCTCGTCATACAGGACCACCAGGCTTGTAGGGTGCTC
AGGCGGGTATATCACCTTCAGCAGAATGACAAGTGGTCTTTGCGGCAGCCAAAGCGCTGCCCGGAGCCTGTACGA
CTTGCCTCCCATTGGGACTCGATGCTGCAGGAGATGAGGTGGATGCGGACAGACTTCCGAGAGGAACGGAAATGG
AAGATGGCCGTCGCGCGCAAGATGGCTCATGCCTGCGCGGAATGGTACGAGGCCGGCCCCGAGGAGCGCAAGTGC
CTTCAAGTCGAGGCGACCCGGCCGCCAACGGCGCGGCCCGTGGAGCGAGGCGCGGACACGATCGACATGGCCGAC
GACGGCATAGAGAACCAGCCAACCCCGGACCTCGTGCCCTCGGGAGACGCCGACTCGCCCCAAAATGTGGACGAT
CTCGTCGAAGATTTTGCCGAGACGGTGGCGCCATCGGCAATCTTCGCTCTGCAAGAAGACGAGGTCGTGTTCGGG
CTGCGCAGGACGGCGGCTTCGGACCAACTGCTGGAGGAGCTGCCCATGTACGGGCTGCCGCTCAAGGCACACAAA
TCCGACGTCATTAGCCCCGACTTCGATCCGGATGCACACTGGCGCCGTCCCGCCTTGCCCTTGAGCAAGTACGTC
GAGGGAGAGATGAAGCTCGTGTCGAATCGCCCTCCGCAGAAGCGCGGTCGGTATTATTATGAGAACGAGGAGGAC
GAGGACGAGGACGAGGACAGGGACGGCCAGTTCGTGCGCGACCAGCTCGTTCACAACATGCGGCTGCCCCCCAGC
ACGGACGAGGTCTCGTTGTTTCACCCCGAGTCGAAGCACATACGCGATCGCCTGCACGCCGGCCACCAGTTCCGG
CCACCGTCCGAGCATCCCATGCCGACCCAAAGCTTCTACGAATCCCGCAGCCCCTCCCAATGGACCCTGGCCGAG
GACGATGAGCTCCGCGGGCTTGTGCGGGAGTACTCGTACAACTGGTCTCTCATCTCGAGCATACTGTCGACGAAG
TCTTCCTTCGCGGCCGGGGCGGAGAGGCGGACGCCTTGGGAATGTTTTGAGCGCTGGATCAATCTCGAGGGCCTG
CCAGCGGACATGCAGAAGACGCAGTACTTCAAGGCTTACAACAGCAGGATCGAGGCTGCTCAGAAGGTCATTGCA
CAGCAGAATCAGCTGGCTGCGCAACAGGCTTCGGCAGCCGGAGCCGCCGTGACGCCCATGCGGCGACGACCTTCC
CTGCCTCTGAGGGTGGAGAAACGCCGCAACCAGAAGCATTTCACGATGCTGGATGCCATGAGGAAGCTCGCCAAG
AAGAGGGAGACGGCAATCCAGAAGCAGCAGCATTCGGCGTCGCAGAACGCTGCCAACAAGAAGACCAACGAGGCC
ATCTCCCAGAGGCCGGCCAAGACGCCGAGAGACTACAGCCTCATGCGCTGGGAAAGAGACCAAGCTCTGGCGGAG
AAGATGGCCCAGTACGCACAGCGTCAGGAAGCGCAGCGACGAGCGGCCATGCAGGCCAGAGTGCAGGCCCAGGCC
GCCCAAGCCGCCGGCGCTGCCGCGGCCAACATGCCAGCCCAGAACGGGGGACATCTGGCCGCCAATCCCAGCATG
AATGGAGCCGGTCGTCCCATGTCCAGCCACCTCGCCGCCGCCGCGAGCCAAAATCGGCCACGAATGCCGATGCAA
GCTCCTCAGGCCAACGGCGTCGGCATCGGGGGCGTCCAAGCCCAGATGAACGGCGGCCTGTCGGCCCCTCCGCAG
ATGAACGGCTCTCCGCAGACACAAGTGCCAGGGGCGCAAGCACAGCATAGGATGCCCATGCCGAACCAGCAGCCG
GACGCGAGCTTGATGCTGCGTGCTCAACGCATCTCGGAGCAGCAGCGTGCCGCTGTCCAGATCCAGCAGCAACAG
CAAGTCCAACAACAGCATCAACAGCAGGTCCAGCAGCAAGTCCCGCAGCAGCAGCAGCAGCAGCCGCCGCCGCAG
CAGCCGCAGCAACTGGGCAATCCCGGCACCCCTGGCGCGACGACGAGCCAACACAACTCGCCGTCCATGCGGAAC
GGTGTTAACGGCATCAGCCAGCAGTCGTTCATGAGTAACCCTCAGGCTATGATGGCATCGTATGCCGCCGCCGCC
ACCGCCAACGGCAACGGTCTCGGGGTGTCGCAGGCAAACGGCGTTCACCTTCCGGCCGCAGCCAACGGGTCGTCT
CCCGGACAGCGCACACACACGCAGCTGCCGCCCGGCATCGCCGCACAGCTGAACCACCTGGAGACGAGTTTCAGG
GCTAAGAACCCTAACCTGACGCCCGAGCAGGCACGGCAGCTGGCCACGGAGCATCTCACGCGGGCCATGATGGCC
CAGCGGCAGAATGCCATGAACGCTGCTGCAGGCGCCTCGGGCCAGACTAGCATCGCCAACAGCATGGCTGCGACA
ACGAGCCCGCACCAGTACGCGGCGCTGCTTCGGCAGCAGCAGCAGGCCCAGCAGGCCCAGCAGGCCCAGCAGCAG
CAGCAGGCTCAACCGCACAAGGCCCAACACCATCAGGCCCAGCAGCAGCAGCATCAAGCTCAGGCCCAGCAGGCC
CAGCAGGCCCAGCAGCAGCAGCACCACGGCCAGCAGCAGCAAAGCCAGCCACGCCCGGCTCAGCAACTGCAGCAA
CAACACCAGCATCACGTCCAGTCCCAGCAGCACCAGCAGGCCCAGCAGCAACACCACCAGCTCCTGCAGCAGCAG
CAGCAGCGCCAGCCGCCCAAGCCGCAGCCACCGCAGCAGCAGCCACTTCAACAACAGCCGCAGCCGCAGTACCAG
CAGCACGCGGGCACGAAGCAGGGCACGCCCGTCCCTGCCCCCGCCGCCACGCCGGCAGCGGCGTCCGCCAGCCCC
GCGCAGTCCCACCAGCGCACGTCGAGCGGCAGCGCGACACCGTCGGCGCTGGGAAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail