Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6801
Gene name
LocationContig_364:12257..14514
Strand+
Gene length (bp)2257
Transcript length (bp)1974
Coding sequence length (bp)1974
Protein length (aa) 658

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 1.0E-72 44 454

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04121|NHX1_YEAST Endosomal/prevacuolar sodium/hydrogen exchanger OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHX1 PE=1 SV=1 22 476 0.0E+00
sp|O13726|YDO6_SCHPO Uncharacterized Na(+)/H(+) antiporter C15A10.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15A10.06 PE=1 SV=3 11 471 3.0E-178
sp|Q8BZ00|SL9A9_MOUSE Sodium/hydrogen exchanger 9 OS=Mus musculus GN=Slc9a9 PE=2 SV=1 85 462 1.0E-84
sp|Q8IVB4|SL9A9_HUMAN Sodium/hydrogen exchanger 9 OS=Homo sapiens GN=SLC9A9 PE=1 SV=1 85 585 3.0E-84
sp|Q92581|SL9A6_HUMAN Sodium/hydrogen exchanger 6 OS=Homo sapiens GN=SLC9A6 PE=1 SV=2 56 471 9.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04121|NHX1_YEAST Endosomal/prevacuolar sodium/hydrogen exchanger OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHX1 PE=1 SV=1 22 476 0.0E+00
sp|O13726|YDO6_SCHPO Uncharacterized Na(+)/H(+) antiporter C15A10.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15A10.06 PE=1 SV=3 11 471 3.0E-178
sp|Q8BZ00|SL9A9_MOUSE Sodium/hydrogen exchanger 9 OS=Mus musculus GN=Slc9a9 PE=2 SV=1 85 462 1.0E-84
sp|Q8IVB4|SL9A9_HUMAN Sodium/hydrogen exchanger 9 OS=Homo sapiens GN=SLC9A9 PE=1 SV=1 85 585 3.0E-84
sp|Q92581|SL9A6_HUMAN Sodium/hydrogen exchanger 6 OS=Homo sapiens GN=SLC9A6 PE=1 SV=2 56 471 9.0E-83
sp|Q8BLV3|SL9A7_MOUSE Sodium/hydrogen exchanger 7 OS=Mus musculus GN=Slc9a7 PE=1 SV=1 83 471 2.0E-80
sp|Q96T83|SL9A7_HUMAN Sodium/hydrogen exchanger 7 OS=Homo sapiens GN=SLC9A7 PE=1 SV=1 78 513 2.0E-78
sp|Q8RWU6|NHX6_ARATH Sodium/hydrogen exchanger 6 OS=Arabidopsis thaliana GN=NHX6 PE=1 SV=3 22 474 1.0E-70
sp|Q9Y2E8|SL9A8_HUMAN Sodium/hydrogen exchanger 8 OS=Homo sapiens GN=SLC9A8 PE=1 SV=4 24 470 1.0E-67
sp|Q5ZJ75|SL9A8_CHICK Sodium/hydrogen exchanger 8 OS=Gallus gallus PE=2 SV=1 27 470 3.0E-67
sp|Q8R4D1|SL9A8_MOUSE Sodium/hydrogen exchanger 8 OS=Mus musculus GN=Slc9a8 PE=1 SV=1 24 485 6.0E-67
sp|Q4L208|SL9A8_RAT Sodium/hydrogen exchanger 8 OS=Rattus norvegicus GN=Slc9a8 PE=2 SV=1 24 485 1.0E-66
sp|Q552S0|NHE1_DICDI Sodium/hydrogen exchanger 1 OS=Dictyostelium discoideum GN=nhe1 PE=2 SV=1 30 465 2.0E-64
sp|Q8S396|NHX5_ARATH Sodium/hydrogen exchanger 5 OS=Arabidopsis thaliana GN=NHX5 PE=2 SV=2 20 458 2.0E-60
sp|Q8S397|NHX4_ARATH Sodium/hydrogen exchanger 4 OS=Arabidopsis thaliana GN=NHX4 PE=2 SV=2 38 456 3.0E-54
sp|Q4R8V4|SL9A8_MACFA Sodium/hydrogen exchanger 8 OS=Macaca fascicularis GN=SLC9A8 PE=2 SV=1 24 470 3.0E-51
sp|P48763|SL9A2_RAT Sodium/hydrogen exchanger 2 OS=Rattus norvegicus GN=Slc9a2 PE=1 SV=1 54 477 4.0E-49
sp|P50482|SL9A2_RABIT Sodium/hydrogen exchanger 2 OS=Oryctolagus cuniculus GN=SLC9A2 PE=2 SV=1 54 477 6.0E-49
sp|Q01345|NHEB_ONCMY Na(+)/H(+) exchanger beta OS=Oncorhynchus mykiss PE=2 SV=1 64 475 3.0E-48
sp|P26432|SL9A3_RABIT Sodium/hydrogen exchanger 3 OS=Oryctolagus cuniculus GN=SLC9A3 PE=1 SV=1 99 497 1.0E-46
sp|Q84WG1|NHX3_ARATH Sodium/hydrogen exchanger 3 OS=Arabidopsis thaliana GN=NHX3 PE=2 SV=2 6 446 1.0E-46
sp|Q9UBY0|SL9A2_HUMAN Sodium/hydrogen exchanger 2 OS=Homo sapiens GN=SLC9A2 PE=2 SV=1 54 466 2.0E-46
sp|Q68KI4|NHX1_ARATH Sodium/hydrogen exchanger 1 OS=Arabidopsis thaliana GN=NHX1 PE=1 SV=2 38 471 1.0E-45
sp|P48764|SL9A3_HUMAN Sodium/hydrogen exchanger 3 OS=Homo sapiens GN=SLC9A3 PE=1 SV=2 99 459 1.0E-45
sp|Q56XP4|NHX2_ARATH Sodium/hydrogen exchanger 2 OS=Arabidopsis thaliana GN=NHX2 PE=2 SV=2 64 456 1.0E-45
sp|G3X939|SL9A3_MOUSE Sodium/hydrogen exchanger 3 OS=Mus musculus GN=Slc9a3 PE=1 SV=1 99 497 3.0E-45
sp|P26433|SL9A3_RAT Sodium/hydrogen exchanger 3 OS=Rattus norvegicus GN=Slc9a3 PE=1 SV=1 99 497 1.0E-44
sp|M5A7P9|SL9A3_TRISC Sodium/hydrogen exchanger 3 OS=Triakis scyllium GN=slc9a3 PE=1 SV=1 99 465 5.0E-44
sp|Q28362|SL9A3_DIDVI Sodium/hydrogen exchanger 3 OS=Didelphis virginiana GN=SLC9A3 PE=1 SV=1 99 497 6.0E-43
sp|Q6AI14|SL9A4_HUMAN Sodium/hydrogen exchanger 4 OS=Homo sapiens GN=SLC9A4 PE=1 SV=2 66 469 7.0E-43
sp|Q8BUE1|SL9A4_MOUSE Sodium/hydrogen exchanger 4 OS=Mus musculus GN=Slc9a4 PE=2 SV=1 66 469 8.0E-43
sp|P26434|SL9A4_RAT Sodium/hydrogen exchanger 4 OS=Rattus norvegicus GN=Slc9a4 PE=1 SV=1 66 495 3.0E-42
sp|Q14940|SL9A5_HUMAN Sodium/hydrogen exchanger 5 OS=Homo sapiens GN=SLC9A5 PE=1 SV=2 96 422 2.0E-40
sp|G5EBK1|PBO4_CAEEL Na(+)/H(+) exchanger protein 7 OS=Caenorhabditis elegans GN=pbo-4 PE=1 SV=1 66 516 3.0E-40
sp|Q9Z0X2|SL9A5_RAT Sodium/hydrogen exchanger 5 OS=Rattus norvegicus GN=Slc9a5 PE=1 SV=1 96 422 2.0E-39
sp|Q61165|SL9A1_MOUSE Sodium/hydrogen exchanger 1 OS=Mus musculus GN=Slc9a1 PE=1 SV=1 64 459 3.0E-38
sp|P48762|SL9A1_PIG Sodium/hydrogen exchanger 1 OS=Sus scrofa GN=SLC9A1 PE=2 SV=1 64 459 3.0E-38
sp|P26431|SL9A1_RAT Sodium/hydrogen exchanger 1 OS=Rattus norvegicus GN=Slc9a1 PE=1 SV=2 64 459 4.0E-38
sp|P19634|SL9A1_HUMAN Sodium/hydrogen exchanger 1 OS=Homo sapiens GN=SLC9A1 PE=1 SV=2 64 459 1.0E-37
sp|Q28036|SL9A1_BOVIN Sodium/hydrogen exchanger 1 OS=Bos taurus GN=SLC9A1 PE=2 SV=1 64 459 4.0E-37
sp|P23791|SL9A1_RABIT Sodium/hydrogen exchanger 1 OS=Oryctolagus cuniculus GN=SLC9A1 PE=2 SV=1 64 459 6.0E-37
sp|Q8T5S1|NHX2_CAEEL Na(+)/H(+) exchanger protein 2 OS=Caenorhabditis elegans GN=nhx-2 PE=2 SV=1 90 496 1.0E-35
sp|P48761|SL9A1_CRIGR Sodium/hydrogen exchanger 1 OS=Cricetulus griseus GN=SLC9A1 PE=2 SV=1 64 459 2.0E-32
sp|P35449|NHX9_CAEEL Probable Na(+)/H(+) antiporter nhx-9 OS=Caenorhabditis elegans GN=nhx-9 PE=2 SV=2 41 467 2.0E-30
sp|O16452|NHX3_CAEEL Probable Na(+)/H(+) antiporter nhx-3 OS=Caenorhabditis elegans GN=nhx-3 PE=2 SV=2 75 459 3.0E-26
sp|Q2XWL3|NHAH_HALDA Na(+)/H(+) antiporter NhaH OS=Halobacillus dabanensis GN=nhaH PE=1 SV=1 102 458 2.0E-25
sp|B0LJC9|NHAH_HALAD Na(+)/H(+) antiporter NhaH OS=Halobacillus aidingensis GN=nhaH PE=1 SV=1 102 458 5.0E-23
sp|Q93HU4|NHAP_APHHA Na(+)/H(+) antiporter ApNhaP OS=Aphanothece halophytica GN=apnhaP PE=1 SV=1 92 458 9.0E-23
sp|Q9LCB5|NHAG_BACAT Na(+)/H(+) antiporter NhaG OS=Bacillus atrophaeus GN=nhaG PE=1 SV=1 71 565 8.0E-18
sp|Q9LKW9|NHX7_ARATH Sodium/hydrogen exchanger 7 OS=Arabidopsis thaliana GN=NHX7 PE=1 SV=1 86 456 1.0E-16
sp|P73863|NHAS1_SYNY3 Low-affinity Na(+)/H(+) antiporter NhaS1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nhaS1 PE=1 SV=1 91 454 5.0E-16
sp|Q3YL57|NHX8_ARATH Sodium/hydrogen exchanger 8 OS=Arabidopsis thaliana GN=NHX8 PE=2 SV=1 86 460 1.0E-12
sp|P32703|YJCE_ECOLI Uncharacterized Na(+)/H(+) exchanger YjcE OS=Escherichia coli (strain K12) GN=yjcE PE=3 SV=1 93 343 1.0E-09
sp|G3XD29|NHAP_PSEAE Na(+)/H(+) antiporter NhaP OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nhaP PE=1 SV=1 98 439 7.0E-09
sp|A8FHE3|NHAK_BACP2 Sodium, potassium, lithium and rubidium/H(+) antiporter OS=Bacillus pumilus (strain SAFR-032) GN=nhaK PE=3 SV=1 93 417 3.0E-08
sp|A7Z8R4|NHAK_BACMF Sodium, potassium, lithium and rubidium/H(+) antiporter OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=nhaK PE=3 SV=1 94 372 7.0E-08
sp|B5R8Z9|NHAP2_SALG2 K(+)/H(+) antiporter NhaP2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nhaP2 PE=3 SV=1 102 449 9.0E-08
sp|P65524|NHAP2_SALTY K(+)/H(+) antiporter NhaP2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|P65525|NHAP2_SALTI K(+)/H(+) antiporter NhaP2 OS=Salmonella typhi GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|B4TXX1|NHAP2_SALSV K(+)/H(+) antiporter NhaP2 OS=Salmonella schwarzengrund (strain CVM19633) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|B5BI52|NHAP2_SALPK K(+)/H(+) antiporter NhaP2 OS=Salmonella paratyphi A (strain AKU_12601) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|C0Q332|NHAP2_SALPC K(+)/H(+) antiporter NhaP2 OS=Salmonella paratyphi C (strain RKS4594) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|A9MVW9|NHAP2_SALPB K(+)/H(+) antiporter NhaP2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|Q5PN10|NHAP2_SALPA K(+)/H(+) antiporter NhaP2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|B4SUJ3|NHAP2_SALNS K(+)/H(+) antiporter NhaP2 OS=Salmonella newport (strain SL254) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|B5R2W9|NHAP2_SALEP K(+)/H(+) antiporter NhaP2 OS=Salmonella enteritidis PT4 (strain P125109) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|B5FTN3|NHAP2_SALDC K(+)/H(+) antiporter NhaP2 OS=Salmonella dublin (strain CT_02021853) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|Q57NL1|NHAP2_SALCH K(+)/H(+) antiporter NhaP2 OS=Salmonella choleraesuis (strain SC-B67) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|B5F4E6|NHAP2_SALA4 K(+)/H(+) antiporter NhaP2 OS=Salmonella agona (strain SL483) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|B4TKD1|NHAP2_SALHS K(+)/H(+) antiporter NhaP2 OS=Salmonella heidelberg (strain SL476) GN=nhaP2 PE=3 SV=1 102 449 1.0E-07
sp|O32212|NHAK_BACSU Sodium, potassium, lithium and rubidium/H(+) antiporter OS=Bacillus subtilis (strain 168) GN=nhaK PE=1 SV=1 94 372 2.0E-07
sp|Q87VB6|NHAP2_PSESM K(+)/H(+) antiporter NhaP2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nhaP2 PE=3 SV=2 102 455 3.0E-07
sp|Q48P74|NHAP2_PSE14 K(+)/H(+) antiporter NhaP2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=nhaP2 PE=3 SV=2 102 455 3.0E-07
sp|Q4ZZ50|NHAP2_PSEU2 K(+)/H(+) antiporter NhaP2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=nhaP2 PE=3 SV=2 102 455 7.0E-07
sp|C3LSD1|NHAP2_VIBCM K(+)/H(+) antiporter NhaP2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=nhaP2 PE=3 SV=1 93 497 1.0E-06
sp|Q9KNM9|NHAP2_VIBCH K(+)/H(+) antiporter NhaP2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nhaP2 PE=3 SV=1 93 497 1.0E-06
sp|A5F4U3|NHAP2_VIBC3 K(+)/H(+) antiporter NhaP2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=nhaP2 PE=1 SV=1 75 497 2.0E-06
sp|P74393|NHAS2_SYNY3 Na(+)/H(+) antiporter NhaS2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nhaS2 PE=1 SV=1 76 416 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006812 cation transport Yes
GO:0055085 transmembrane transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0008324 cation transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015298 solute:cation antiporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0022804 active transmembrane transporter activity No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0015291 secondary active transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0015297 antiporter activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 63 85 22
3 95 114 19
4 127 149 22
5 164 186 22
6 193 215 22
7 235 257 22
8 270 289 19
9 293 310 17
10 323 345 22
11 355 377 22
12 428 450 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6801
MSAAKVVGMGLQLLRREAEESDPEAGDSAQKELFAAWALFISIMLLITAFFTSYMLQMKKVTAVHETVISIFAGM
IVGLVLLITSGDSIRNLISFDYQIFFNLLLPPIILSSGYELHQANFFRNIGTILTFAFAGTFLSAVVIGLILWFF
SLLPGSLKMTFVDAISVGATLSATDPVTILAIFNTYKVDPKLYTIIFGESILNDAIAIVIFETAQKYNKGVAASY
GLLSFFEGTGIFLLVFFGSLLIGVVVGVGTALLLKFTYLRRLPKIESCLIVLISYATYFFSHGVHLSGIVSLLFC
GITLKHYAYFNMSRRTQLTTKYIFQVISQLSENFIFIYLGLALFTDNALQFQPPLIIVTVLAVCAARWVAVFPLS
RAINWFIRYRARRRGVEVNDELPYNYQAMLFWAGLRGAVGVALAALLSGENSYALRATVLVVVVLTVIIFGGTTA
RMLEILGIRTGVVEEIDSDDEFDIESFGGGIQAKRSGQALGYHPRRNGNVALSTLEAQRPLSASYVSGHSSPLTA
GRPQSVSRKGSSVRSQDDFERADLLGRAAQVEDSDFGSDIDTSDLPPPARRSPRPRASPHPAPQSDSAFMSPSSE
APPAAPITATGAIRQLLSAEDPAGLFRQLDEDFIKPRLLLHGDGGGGRGGGGGGGGG*
Coding >Hirsu2|6801
ATGTCCGCCGCCAAAGTCGTCGGCATGGGCCTCCAGCTCCTCCGGCGGGAAGCCGAAGAGTCTGACCCCGAAGCG
GGCGACTCGGCGCAGAAGGAGCTCTTCGCCGCCTGGGCGCTCTTCATCTCCATCATGCTCCTAATCACCGCCTTC
TTCACCAGCTACATGCTCCAGATGAAAAAGGTCACGGCCGTCCACGAGACCGTCATCTCCATCTTTGCCGGAATG
ATCGTCGGCCTCGTCCTCCTCATCACCTCGGGCGACTCCATCCGAAACCTCATCAGCTTCGACTACCAAATCTTC
TTCAACCTCCTCCTCCCCCCCATCATCCTGTCCTCGGGCTACGAGCTGCACCAGGCCAACTTCTTCCGCAACATC
GGCACCATCCTCACCTTTGCCTTTGCCGGCACCTTCCTCTCCGCCGTCGTCATCGGCCTCATCCTGTGGTTCTTC
AGTCTCCTCCCGGGCTCTCTCAAGATGACCTTCGTCGACGCCATCTCCGTCGGTGCCACCCTCTCCGCCACCGAC
CCCGTCACCATCCTGGCCATATTCAATACCTACAAGGTAGATCCGAAGCTCTACACCATCATCTTCGGCGAGTCC
ATCCTCAATGACGCCATCGCCATCGTCATCTTCGAGACGGCGCAAAAGTACAACAAGGGCGTCGCCGCCAGCTAC
GGCCTCCTCAGCTTCTTCGAGGGCACCGGCATCTTCTTGCTCGTCTTCTTCGGCAGCCTGCTCATTGGCGTCGTC
GTCGGCGTCGGCACCGCTCTCCTCCTCAAGTTCACCTATCTCCGGAGGCTGCCCAAGATTGAGAGCTGTCTGATT
GTCTTGATCTCTTACGCCACCTACTTCTTCTCCCACGGAGTGCACCTCTCCGGCATCGTGTCCTTGCTCTTCTGC
GGCATCACCCTCAAGCATTACGCCTACTTCAACATGTCGAGACGCACCCAGCTCACCACCAAGTACATCTTCCAG
GTCATCTCCCAGCTGTCGGAAAACTTCATCTTCATCTACCTCGGCCTGGCCCTGTTCACGGACAACGCGCTCCAG
TTTCAGCCGCCGCTCATCATCGTCACGGTCCTCGCCGTCTGCGCCGCACGATGGGTCGCCGTCTTCCCCCTGTCG
AGGGCCATCAACTGGTTTATCCGCTACCGGGCCCGCCGCAGGGGAGTCGAGGTCAACGACGAGCTGCCGTACAAC
TACCAGGCCATGCTCTTCTGGGCAGGGCTGCGGGGCGCCGTCGGCGTCGCCCTCGCCGCCCTGCTCAGCGGCGAA
AACTCGTATGCCCTGCGGGCAACCGTCTTGGTTGTGGTCGTGCTCACCGTCATCATCTTCGGCGGCACCACGGCG
CGCATGCTGGAGATTCTGGGCATCCGCACGGGCGTGGTCGAGGAGATTGACAGCGACGACGAGTTCGACATCGAG
TCCTTTGGCGGCGGCATCCAGGCCAAGCGGTCGGGCCAGGCCCTGGGATACCACCCGCGGCGGAACGGCAACGTC
GCCCTCAGCACCCTCGAGGCCCAGAGACCGCTGTCGGCCTCGTACGTGTCGGGTCATTCGTCGCCGCTGACGGCC
GGCCGGCCCCAAAGCGTGAGCCGCAAGGGCTCCTCGGTCCGCAGCCAAGACGACTTCGAGCGCGCCGACCTCCTG
GGCCGCGCCGCCCAGGTCGAGGACTCCGACTTCGGCAGCGACATCGACACGTCCGACCTGCCGCCGCCCGCGCGC
CGCTCTCCGCGCCCGCGCGCCAGCCCGCACCCCGCTCCCCAGTCGGACAGCGCCTTCATGAGCCCGTCGAGCGAG
GCGCCCCCCGCGGCACCCATCACCGCCACCGGCGCCATCCGACAGCTGCTGAGCGCCGAGGACCCGGCCGGCCTG
TTCCGCCAGCTGGACGAGGACTTCATCAAGCCCCGGCTGCTACTACACGGAGACGGAGGCGGCGGCAGGGGAGGC
GGTGGCGGCGGCGGCGGTGGGTGA
Transcript >Hirsu2|6801
ATGTCCGCCGCCAAAGTCGTCGGCATGGGCCTCCAGCTCCTCCGGCGGGAAGCCGAAGAGTCTGACCCCGAAGCG
GGCGACTCGGCGCAGAAGGAGCTCTTCGCCGCCTGGGCGCTCTTCATCTCCATCATGCTCCTAATCACCGCCTTC
TTCACCAGCTACATGCTCCAGATGAAAAAGGTCACGGCCGTCCACGAGACCGTCATCTCCATCTTTGCCGGAATG
ATCGTCGGCCTCGTCCTCCTCATCACCTCGGGCGACTCCATCCGAAACCTCATCAGCTTCGACTACCAAATCTTC
TTCAACCTCCTCCTCCCCCCCATCATCCTGTCCTCGGGCTACGAGCTGCACCAGGCCAACTTCTTCCGCAACATC
GGCACCATCCTCACCTTTGCCTTTGCCGGCACCTTCCTCTCCGCCGTCGTCATCGGCCTCATCCTGTGGTTCTTC
AGTCTCCTCCCGGGCTCTCTCAAGATGACCTTCGTCGACGCCATCTCCGTCGGTGCCACCCTCTCCGCCACCGAC
CCCGTCACCATCCTGGCCATATTCAATACCTACAAGGTAGATCCGAAGCTCTACACCATCATCTTCGGCGAGTCC
ATCCTCAATGACGCCATCGCCATCGTCATCTTCGAGACGGCGCAAAAGTACAACAAGGGCGTCGCCGCCAGCTAC
GGCCTCCTCAGCTTCTTCGAGGGCACCGGCATCTTCTTGCTCGTCTTCTTCGGCAGCCTGCTCATTGGCGTCGTC
GTCGGCGTCGGCACCGCTCTCCTCCTCAAGTTCACCTATCTCCGGAGGCTGCCCAAGATTGAGAGCTGTCTGATT
GTCTTGATCTCTTACGCCACCTACTTCTTCTCCCACGGAGTGCACCTCTCCGGCATCGTGTCCTTGCTCTTCTGC
GGCATCACCCTCAAGCATTACGCCTACTTCAACATGTCGAGACGCACCCAGCTCACCACCAAGTACATCTTCCAG
GTCATCTCCCAGCTGTCGGAAAACTTCATCTTCATCTACCTCGGCCTGGCCCTGTTCACGGACAACGCGCTCCAG
TTTCAGCCGCCGCTCATCATCGTCACGGTCCTCGCCGTCTGCGCCGCACGATGGGTCGCCGTCTTCCCCCTGTCG
AGGGCCATCAACTGGTTTATCCGCTACCGGGCCCGCCGCAGGGGAGTCGAGGTCAACGACGAGCTGCCGTACAAC
TACCAGGCCATGCTCTTCTGGGCAGGGCTGCGGGGCGCCGTCGGCGTCGCCCTCGCCGCCCTGCTCAGCGGCGAA
AACTCGTATGCCCTGCGGGCAACCGTCTTGGTTGTGGTCGTGCTCACCGTCATCATCTTCGGCGGCACCACGGCG
CGCATGCTGGAGATTCTGGGCATCCGCACGGGCGTGGTCGAGGAGATTGACAGCGACGACGAGTTCGACATCGAG
TCCTTTGGCGGCGGCATCCAGGCCAAGCGGTCGGGCCAGGCCCTGGGATACCACCCGCGGCGGAACGGCAACGTC
GCCCTCAGCACCCTCGAGGCCCAGAGACCGCTGTCGGCCTCGTACGTGTCGGGTCATTCGTCGCCGCTGACGGCC
GGCCGGCCCCAAAGCGTGAGCCGCAAGGGCTCCTCGGTCCGCAGCCAAGACGACTTCGAGCGCGCCGACCTCCTG
GGCCGCGCCGCCCAGGTCGAGGACTCCGACTTCGGCAGCGACATCGACACGTCCGACCTGCCGCCGCCCGCGCGC
CGCTCTCCGCGCCCGCGCGCCAGCCCGCACCCCGCTCCCCAGTCGGACAGCGCCTTCATGAGCCCGTCGAGCGAG
GCGCCCCCCGCGGCACCCATCACCGCCACCGGCGCCATCCGACAGCTGCTGAGCGCCGAGGACCCGGCCGGCCTG
TTCCGCCAGCTGGACGAGGACTTCATCAAGCCCCGGCTGCTACTACACGGAGACGGAGGCGGCGGCAGGGGAGGC
GGTGGCGGCGGCGGCGGTGGGTGA
Gene >Hirsu2|6801
ATGTCCGCCGCCAAAGTCGTCGGCATGGGCCTCCAGCTCCTCCGTACGTCCAGCCGCCAGGCGCCCTCCCTCCGA
GCCCTCTTCCTCCTCTCGTCGCTGACATCTTCTCCCACAGGGCGGGAAGCCGAAGAGTCTGACCCCGAAGGTGCG
TTGCCCGCGACGGCCTCCGTCCCGCCGAGGCGACCCCGCCGCCGAATCCTGCTGACGATGCCGACGCAGCGGGCG
ACTCGGCGCAGAAGGAGCTCTTCGCCGCCTGGGCGCTCTTCATCTCCATCATGCTCCTAATCACCGCCTTCTTCA
CCAGCTACATGCTCCAGATGAAAAAGGTCACGGCCGTCCACGAGACCGTCATCTCCATCTTTGCCGGTGCGGCCG
AGCAGCCCCCTTCAGCCCCATCCTTCTTCATCCATCCCGCTGACGCCCGACCTCGCCAGGAATGATCGTCGGCCT
CGTCCTCCTCATCACCTCGGGCGACTCCATCCGAAACCTCATCAGCTTCGACTACCAAATCTTCTTCAACCTCCT
CCTCCCCCCCATCATCCTGTCCTCGGGCTACGAGCTGCACCAGGCCAACTTCTTCCGCAACATCGGCACCATCCT
CACCTTTGCCTTTGCCGGCACCTTCCTCTCCGCCGTCGTCATCGGCCTCATCCTGTGGTTCTTCAGTCTCCTCCC
GGGCTCTCTCAAGATGACCTTCGTCGACGCCATCTCCGTCGGTGCCACCCTCTCCGCCACCGACCCCGTCACCAT
CCTGGCCATATTCAATACCTACAAGGTAGATCCGAAGCTCTACACCATCATCTTCGGCGAGTCCATCCTCAATGA
CGCCATCGCCATCGTCATCTTCGAGACGGCGCAAAAGTACAACAAGGGCGTCGCCGCCAGCTACGGCCTCCTCAG
CTTCTTCGAGGGCACCGGCATCTTCTTGCTCGTCTTCTTCGGCAGCCTGCTCATTGGCGTCGTCGTCGGCGTCGG
CACCGCTCTCCTCCTCAAGTTCACCTATCTCCGGAGGCTGCCCAAGATTGAGAGCTGTCTGATTGTCTTGATCTC
TTACGCCACCTACTTCTTCTCCCACGGAGTGCACCTCTCCGGTAGGCGCTCCCCCACCCCCGACCCGCCATGATG
GCTTCGTCGACTAACCCGCGCCGCCACACCCAAAGGCATCGTGTCCTTGCTCTTCTGCGGCATCACCCTCAAGCA
TTACGCCTACTTCAACATGTCGAGACGCACCCAGCTCACCACCAAGTACATCTTCCAGGTCATCTCCCAGCTGTC
GGAAAACTTCATCTTCATCTACCTCGGCCTGGCCCTGTTCACGGACAACGCGCTCCAGTTTCAGCCGCCGCTCAT
CATCGTCACGGTCCTCGCCGTCTGCGCCGCACGATGGGTCGCCGTCTTCCCCCTGTCGAGGGCCATCAACTGGTT
TATCCGCTACCGGGCCCGCCGCAGGGGAGTCGAGGTCAACGACGAGCTGCCGTACAACTACCAGGCCATGCTCTT
CTGGGCAGGGCTGCGGGGCGCCGTCGGCGTCGCCCTCGCCGCCCTGCTCAGCGGCGAAAACTCGTATGCCCTGCG
GGCAACCGTCTTGGTTGTGGTCGTGCTCACCGTCATCATCTTCGGCGGCACCACGGCGCGCATGCTGGAGATTCT
GGGCATCCGCACGGGCGTGGTCGAGGAGATTGACAGCGACGACGAGTTCGACATCGAGTCCTTTGGCGGCGGCAT
CCAGGCCAAGCGGTCGGGCCAGGCCCTGGGATACCACCCGCGGCGGAACGGCAACGTCGCCCTCAGCACCCTCGA
GGCCCAGAGACCGCTGTCGGCCTCGTACGTGTCGGGTCATTCGTCGCCGCTGACGGCCGGCCGGCCCCAAAGCGT
GAGCCGCAAGGGCTCCTCGGTCCGCAGCCAAGACGACTTCGAGCGCGCCGACCTCCTGGGCCGCGCCGCCCAGGT
CGAGGACTCCGACTTCGGCAGCGACATCGACACGTCCGACCTGCCGCCGCCCGCGCGCCGCTCTCCGCGCCCGCG
CGCCAGCCCGCACCCCGCTCCCCAGTCGGACAGCGCCTTCATGAGCCCGTCGAGCGAGGCGCCCCCCGCGGCACC
CATCACCGCCACCGGCGCCATCCGACAGCTGCTGAGCGCCGAGGACCCGGCCGGCCTGTTCCGCCAGCTGGACGA
GGACTTCATCAAGCCCCGGCTGCTACTACACGGAGACGGAGGCGGCGGCAGGGGAGGCGGTGGCGGCGGCGGCGG
TGGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail