Protein ID | Hirsu2|6794 |
Gene name | |
Location | Contig_363:11567..13581 |
Strand | + |
Gene length (bp) | 2014 |
Transcript length (bp) | 1587 |
Coding sequence length (bp) | 1587 |
Protein length (aa) | 529 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00067 | p450 | Cytochrome P450 | 1.2E-60 | 55 | 480 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 7 | 499 | 3.0E-67 |
sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 36 | 478 | 1.0E-52 |
sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 25 | 486 | 3.0E-52 |
sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 25 | 486 | 3.0E-52 |
sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 20 | 486 | 3.0E-51 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 7 | 499 | 3.0E-67 |
sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 36 | 478 | 1.0E-52 |
sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 25 | 486 | 3.0E-52 |
sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 25 | 486 | 3.0E-52 |
sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 20 | 486 | 3.0E-51 |
sp|Q12732|AVNA_ASPPA | Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 | 26 | 480 | 5.0E-48 |
sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 29 | 479 | 8.0E-48 |
sp|Q9UW95|AFLL_ASPPA | Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 | 20 | 489 | 1.0E-46 |
sp|Q00707|STCL_EMENI | Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 | 10 | 479 | 7.0E-45 |
sp|O00061|CP67_UROFA | Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 | 26 | 486 | 2.0E-44 |
sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 10 | 479 | 2.0E-42 |
sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 9 | 479 | 2.0E-39 |
sp|Q12612|TRI4_FUSSP | Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 | 12 | 479 | 1.0E-28 |
sp|Q12608|STCB_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 | 32 | 466 | 3.0E-28 |
sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 9 | 474 | 2.0E-24 |
sp|P51871|CP4F6_RAT | Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 | 244 | 496 | 6.0E-23 |
sp|Q9EP75|CP4FE_MOUSE | Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 | 127 | 496 | 6.0E-22 |
sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 122 | 474 | 7.0E-22 |
sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 122 | 474 | 1.0E-21 |
sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 124 | 474 | 1.0E-21 |
sp|Q8SPK0|CP4AP_PIG | Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 | 249 | 479 | 2.0E-21 |
sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 116 | 474 | 2.0E-21 |
sp|O09158|CP3AP_MOUSE | Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 | 13 | 508 | 3.0E-21 |
sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 9 | 508 | 3.0E-21 |
sp|Q99N16|CP4F3_MOUSE | Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 | 272 | 496 | 4.0E-21 |
sp|Q64581|CP3AI_RAT | Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 | 13 | 508 | 4.0E-21 |
sp|Q8SPK1|CP4AO_PIG | Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 | 249 | 479 | 6.0E-21 |
sp|Q3MID2|CP4F3_RAT | Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 | 272 | 496 | 7.0E-21 |
sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 91 | 514 | 1.0E-20 |
sp|Q9VE01|C12A5_DROME | Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 | 301 | 479 | 1.0E-20 |
sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 40 | 508 | 1.0E-20 |
sp|P33274|CP4F1_RAT | Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 | 244 | 496 | 1.0E-20 |
sp|P51869|CP4F4_RAT | Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 | 272 | 496 | 1.0E-20 |
sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 120 | 508 | 2.0E-20 |
sp|P78329|CP4F2_HUMAN | Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 | 127 | 496 | 2.0E-20 |
sp|Q08477|CP4F3_HUMAN | Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 | 124 | 496 | 2.0E-20 |
sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 122 | 474 | 3.0E-20 |
sp|Q8AXY5|C356_FUNHE | Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 | 91 | 508 | 3.0E-20 |
sp|Q9PVE8|C330_FUNHE | Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 | 128 | 508 | 4.0E-20 |
sp|P51870|CP4F5_RAT | Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 | 262 | 496 | 4.0E-20 |
sp|Q9V5L3|C49A1_DROME | Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 | 301 | 479 | 5.0E-20 |
sp|O46051|C4D14_DROME | Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 | 66 | 479 | 6.0E-20 |
sp|Q948Y1|C719A_COPJA | (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 | 161 | 471 | 1.0E-19 |
sp|P14580|CP4A6_RABIT | Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 | 249 | 479 | 2.0E-19 |
sp|Q9GJX5|CP4AL_PIG | Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 | 249 | 479 | 2.0E-19 |
sp|Q9VXY0|CP4S3_DROME | Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 | 10 | 477 | 3.0E-19 |
sp|P15128|CP4B1_RABIT | Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 | 92 | 479 | 3.0E-19 |
sp|O18993|CP3AL_CALJA | Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 | 128 | 474 | 4.0E-19 |
sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 116 | 474 | 5.0E-19 |
sp|Q27518|C13A2_CAEEL | Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 | 128 | 477 | 8.0E-19 |
sp|P20815|CP3A5_HUMAN | Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 | 122 | 474 | 8.0E-19 |
sp|Q9V7G5|C4AA1_DROME | Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 | 284 | 484 | 8.0E-19 |
sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 150 | 474 | 1.0E-18 |
sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 150 | 474 | 1.0E-18 |
sp|Q64462|CP4B1_MOUSE | Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 | 92 | 478 | 1.0E-18 |
sp|Q9HCS2|CP4FC_HUMAN | Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 | 127 | 496 | 1.0E-18 |
sp|Q9HBI6|CP4FB_HUMAN | Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 | 272 | 474 | 2.0E-18 |
sp|O44220|C12B1_DROAC | Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 | 301 | 479 | 2.0E-18 |
sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 120 | 474 | 2.0E-18 |
sp|P20817|CP4AE_RAT | Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 | 255 | 479 | 2.0E-18 |
sp|P98187|CP4F8_HUMAN | Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 | 272 | 474 | 2.0E-18 |
sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 128 | 474 | 2.0E-18 |
sp|Q9W011|C4D20_DROME | Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 | 71 | 479 | 3.0E-18 |
sp|Q9VE00|C12A4_DROME | Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 | 301 | 479 | 3.0E-18 |
sp|P14581|CP4A7_RABIT | Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 | 249 | 479 | 4.0E-18 |
sp|P08516|CP4AA_RAT | Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 | 255 | 479 | 4.0E-18 |
sp|P14579|CP4A5_RABIT | Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 | 249 | 479 | 5.0E-18 |
sp|O88833|CP4AA_MOUSE | Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 | 255 | 479 | 6.0E-18 |
sp|P29980|CPXN_NOSS1 | Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 | 260 | 493 | 7.0E-18 |
sp|Q02928|CP4AB_HUMAN | Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 | 255 | 479 | 7.0E-18 |
sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 116 | 480 | 8.0E-18 |
sp|P30612|CP52P_CANTR | Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 | 301 | 474 | 8.0E-18 |
sp|Q86W10|CP4Z1_HUMAN | Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 | 255 | 479 | 1.0E-17 |
sp|P82713|CP392_DROME | Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 | 254 | 474 | 1.0E-17 |
sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 40 | 474 | 1.0E-17 |
sp|A2RRT9|CP4V2_RAT | Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 | 261 | 474 | 1.0E-17 |
sp|O35728|CP4AE_MOUSE | Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 | 255 | 479 | 1.0E-17 |
sp|Q6NT55|CP4FN_HUMAN | Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 | 272 | 496 | 1.0E-17 |
sp|P20816|CP4A2_RAT | Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 | 255 | 479 | 1.0E-17 |
sp|P15129|CP4B1_RAT | Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 | 72 | 478 | 1.0E-17 |
sp|Q9VFP1|CP6D5_DROME | Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 | 186 | 479 | 2.0E-17 |
sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 91 | 507 | 2.0E-17 |
sp|P33269|CP4D1_DROME | Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 | 8 | 479 | 2.0E-17 |
sp|Q9VCW1|CP6D4_DROME | Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 | 186 | 479 | 2.0E-17 |
sp|O16805|CP4D1_DROSI | Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 | 34 | 479 | 2.0E-17 |
sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 65 | 474 | 2.0E-17 |
sp|Q91WL5|CP4CA_MOUSE | Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 | 272 | 479 | 3.0E-17 |
sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 91 | 474 | 3.0E-17 |
sp|P13584|CP4B1_HUMAN | Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 | 255 | 479 | 4.0E-17 |
sp|Q9VGZ0|C12E1_DROME | Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 | 301 | 491 | 4.0E-17 |
sp|Q27520|C13A1_CAEEL | Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 | 128 | 488 | 6.0E-17 |
sp|Q9VA27|CP4C3_DROME | Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 | 286 | 479 | 7.0E-17 |
sp|Q27517|C13A3_CAEEL | Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 | 128 | 480 | 8.0E-17 |
sp|Q9LTL2|C71BP_ARATH | Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 | 258 | 480 | 9.0E-17 |
sp|Q9V8M2|C12B2_DROME | Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 | 301 | 477 | 1.0E-16 |
sp|Q9VYQ7|CP311_DROME | Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 | 286 | 479 | 1.0E-16 |
sp|P24464|CP4AC_RAT | Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 | 255 | 479 | 1.0E-16 |
sp|Q8N118|CP4X1_HUMAN | Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 | 271 | 474 | 1.0E-16 |
sp|Q9VVR9|C12C1_DROME | Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 | 301 | 492 | 1.0E-16 |
sp|Q9DBW0|CP4V2_MOUSE | Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 | 261 | 474 | 1.0E-16 |
sp|Q9Y757|CP52L_DEBHN | Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 | 273 | 477 | 2.0E-16 |
sp|Q50LH4|C7193_ESCCA | (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 | 303 | 477 | 2.0E-16 |
sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 293 | 474 | 2.0E-16 |
sp|Q9LIP5|C71BW_ARATH | Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 | 62 | 486 | 2.0E-16 |
sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 40 | 474 | 2.0E-16 |
sp|Q9Y6A2|CP46A_HUMAN | Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 | 70 | 484 | 2.0E-16 |
sp|Q09128|CP24A_RAT | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 | 139 | 479 | 2.0E-16 |
sp|Q5TCH4|CP4AM_HUMAN | Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 | 128 | 479 | 3.0E-16 |
sp|Q964Q7|CP6D3_MUSDO | Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 | 171 | 479 | 3.0E-16 |
sp|Q6ZWL3|CP4V2_HUMAN | Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 | 267 | 474 | 4.0E-16 |
sp|Q27519|C13A7_CAEEL | Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 | 128 | 477 | 4.0E-16 |
sp|P58049|C71BB_ARATH | Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 | 304 | 486 | 4.0E-16 |
sp|Q55AJ4|C516B_DICDI | Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 | 243 | 501 | 5.0E-16 |
sp|Q9V773|C6A20_DROME | Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 | 107 | 480 | 5.0E-16 |
sp|P82711|C6A19_DROME | Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 | 113 | 480 | 5.0E-16 |
sp|Q6A152|CP4X1_MOUSE | Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 | 253 | 474 | 6.0E-16 |
sp|P10615|CP52A_CANTR | Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 | 301 | 507 | 6.0E-16 |
sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 128 | 474 | 7.0E-16 |
sp|Q12581|CP52X_CANMA | Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 | 273 | 474 | 7.0E-16 |
sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 259 | 480 | 8.0E-16 |
sp|P58051|C71BE_ARATH | Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 | 266 | 486 | 9.0E-16 |
sp|O81970|C71A9_SOYBN | Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 | 269 | 485 | 1.0E-15 |
sp|Q9SAE3|C71BS_ARATH | Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 | 266 | 478 | 2.0E-15 |
sp|Q9FMY1|C86B1_ARATH | Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 | 265 | 484 | 2.0E-15 |
sp|B1NF19|C719D_ARGME | (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 | 303 | 471 | 2.0E-15 |
sp|Q964T1|CP4CU_BLAGE | Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 | 36 | 487 | 2.0E-15 |
sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 91 | 474 | 2.0E-15 |
sp|Q50LH3|C7192_ESCCA | (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 | 303 | 477 | 2.0E-15 |
sp|P58050|C71BD_ARATH | Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 | 270 | 486 | 2.0E-15 |
sp|Q5RCN6|CP4V2_PONAB | Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 | 267 | 474 | 2.0E-15 |
sp|P30607|CP52B_CANTR | Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 | 301 | 474 | 2.0E-15 |
sp|P10611|CP4A4_RABIT | Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 | 249 | 479 | 3.0E-15 |
sp|O18635|C12A2_MUSDO | Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 | 301 | 474 | 3.0E-15 |
sp|Q9V419|C28A5_DROME | Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 | 259 | 499 | 3.0E-15 |
sp|Q9LIP6|C71BV_ARATH | Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 | 62 | 487 | 3.0E-15 |
sp|Q8K4D6|CP4X1_RAT | Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 | 255 | 474 | 3.0E-15 |
sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 286 | 479 | 3.0E-15 |
sp|Q9VLZ7|C4D21_DROME | Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 | 8 | 479 | 3.0E-15 |
sp|Q9ZU07|C71BC_ARATH | Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 | 304 | 485 | 3.0E-15 |
sp|P30608|CP52F_CANTR | Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 | 251 | 478 | 4.0E-15 |
sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 91 | 474 | 4.0E-15 |
sp|O73853|CP17A_ICTPU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 | 270 | 479 | 5.0E-15 |
sp|G3GBK0|C7BL3_CICIN | Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 | 261 | 485 | 5.0E-15 |
sp|O49342|C71AD_ARATH | Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 | 264 | 484 | 5.0E-15 |
sp|O48921|C97B2_SOYBN | Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 | 301 | 479 | 5.0E-15 |
sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 122 | 474 | 6.0E-15 |
sp|P49264|C71B1_THLAR | Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 | 301 | 485 | 6.0E-15 |
sp|P24458|CP52E_CANMA | Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 | 254 | 478 | 6.0E-15 |
sp|Q07973|CP24A_HUMAN | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 | 289 | 480 | 7.0E-15 |
sp|B5BSX1|BAMO_GLYUR | Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 | 266 | 481 | 9.0E-15 |
sp|O35084|CP27B_MOUSE | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 | 287 | 479 | 1.0E-14 |
sp|Q12586|CP52I_CANMA | Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 | 273 | 474 | 1.0E-14 |
sp|Q00714|STCS_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 | 300 | 479 | 1.0E-14 |
sp|Q43068|C82A1_PEA | Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | 128 | 479 | 1.0E-14 |
sp|O18596|C4D10_DROMT | Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 | 297 | 479 | 2.0E-14 |
sp|Q9LTM7|C71BG_ARATH | Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 | 175 | 485 | 2.0E-14 |
sp|B5UAQ8|C7195_ESCCA | Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 | 305 | 483 | 2.0E-14 |
sp|O46054|C4AE1_DROME | Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 | 286 | 479 | 2.0E-14 |
sp|O23365|C97B3_ARATH | Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 | 301 | 479 | 2.0E-14 |
sp|P16141|CP52D_CANMA | Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 | 301 | 474 | 2.0E-14 |
sp|Q9V4T5|CP4E1_DROME | Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 | 8 | 483 | 2.0E-14 |
sp|Q556M5|C5081_DICDI | Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 | 251 | 490 | 3.0E-14 |
sp|Q9LTM0|C71BN_ARATH | Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 | 167 | 478 | 3.0E-14 |
sp|Q09653|C13AA_CAEEL | Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 | 128 | 488 | 3.0E-14 |
sp|Q96514|C71B7_ARATH | Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 | 14 | 484 | 3.0E-14 |
sp|P16496|CP52C_CANMA | Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 | 248 | 478 | 4.0E-14 |
sp|Q9Y758|CP52M_DEBHN | Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 | 273 | 478 | 4.0E-14 |
sp|Q27606|CP4E2_DROME | Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 | 60 | 483 | 5.0E-14 |
sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 285 | 491 | 5.0E-14 |
sp|Q9V4U9|C6A13_DROME | Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 | 130 | 488 | 5.0E-14 |
sp|Q27514|C13A5_CAEEL | Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 | 128 | 488 | 6.0E-14 |
sp|Q64441|CP24A_MOUSE | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 | 69 | 479 | 6.0E-14 |
sp|Q12588|CP52J_CANMA | Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 | 253 | 474 | 8.0E-14 |
sp|Q12589|CP52K_CANMA | Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 | 253 | 478 | 8.0E-14 |
sp|O81345|C79B1_SINAL | Cytochrome P450 79B1 OS=Sinapis alba GN=CYP79B1 PE=2 SV=1 | 265 | 474 | 9.0E-14 |
sp|Q947B7|MFS_MENPI | (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 | 301 | 484 | 1.0E-13 |
sp|Q9V4U7|C6A14_DROME | Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 | 130 | 488 | 1.0E-13 |
sp|F2Z9C1|P6H_ESCCA | Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 | 301 | 510 | 1.0E-13 |
sp|Q27513|C13A4_CAEEL | Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 | 55 | 488 | 2.0E-13 |
sp|P48421|C83A1_ARATH | Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 | 301 | 508 | 2.0E-13 |
sp|Q6YTF5|C76M5_ORYSJ | Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 | 304 | 485 | 2.0E-13 |
sp|Q9WVK8|CP46A_MOUSE | Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 | 128 | 484 | 2.0E-13 |
sp|P37118|C71A2_SOLME | Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 | 304 | 485 | 2.0E-13 |
sp|F8S1I0|C7BL2_LACSA | Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 | 261 | 485 | 2.0E-13 |
sp|O81346|C79B2_ARATH | Tryptophan N-monooxygenase 1 OS=Arabidopsis thaliana GN=CYP79B2 PE=1 SV=2 | 253 | 474 | 2.0E-13 |
sp|Q09660|CC44_CAEEL | Probable cytochrome P450 CYP44 OS=Caenorhabditis elegans GN=cyp-44A1 PE=3 SV=2 | 305 | 480 | 2.0E-13 |
sp|Q9CAD6|C86A7_ARATH | Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 | 169 | 484 | 2.0E-13 |
sp|Q43135|C79A1_SORBI | Tyrosine N-monooxygenase OS=Sorghum bicolor GN=CYP79A1 PE=1 SV=3 | 263 | 494 | 3.0E-13 |
sp|Q9VL92|CP4E3_DROME | Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 | 286 | 498 | 3.0E-13 |
sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 175 | 495 | 3.0E-13 |
sp|Q50EK4|C75A1_PINTA | Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 | 227 | 480 | 3.0E-13 |
sp|Q9SZ46|C82C4_ARATH | Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 | 301 | 489 | 3.0E-13 |
sp|Q9LTL8|C71BO_ARATH | Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 | 269 | 480 | 3.0E-13 |
sp|O49858|C82A3_SOYBN | Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 | 260 | 479 | 3.0E-13 |
sp|Q9FUY7|C79F2_ARATH | Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2 | 252 | 474 | 3.0E-13 |
sp|O22307|C71DB_LOTJA | Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 | 261 | 487 | 3.0E-13 |
sp|Q9LVD2|C71BA_ARATH | Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 | 158 | 485 | 5.0E-13 |
sp|D5JBW8|GAO_CICIN | Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 | 304 | 511 | 5.0E-13 |
sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 255 | 487 | 6.0E-13 |
sp|Q9V559|CP4P3_DROME | Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 | 101 | 479 | 6.0E-13 |
sp|Q949U1|C79F1_ARATH | Dihomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F1 PE=1 SV=1 | 252 | 474 | 6.0E-13 |
sp|Q59990|CP120_SYNY3 | Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 | 67 | 478 | 6.0E-13 |
sp|P14779|CPXB_BACME | Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 | 258 | 478 | 6.0E-13 |
sp|O48958|C71E1_SORBI | 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 | 303 | 478 | 6.0E-13 |
sp|Q9V770|C6A17_DROME | Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 | 188 | 471 | 7.0E-13 |
sp|O65788|C71B2_ARATH | Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 | 301 | 478 | 7.0E-13 |
sp|Q9SAE4|C71BT_ARATH | Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 | 263 | 478 | 8.0E-13 |
sp|P58048|C71B8_ARATH | Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 | 242 | 478 | 8.0E-13 |
sp|D4AY62|A1131_ARTBC | Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 | 301 | 489 | 1.0E-12 |
sp|Q9W223|CP6D2_DROME | Probable cytochrome P450 6d2 OS=Drosophila melanogaster GN=Cyp6d2 PE=2 SV=1 | 130 | 479 | 1.0E-12 |
sp|Q6UEG2|AFLN_ASPPA | P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 | 300 | 482 | 1.0E-12 |
sp|Q501D8|C79B3_ARATH | Tryptophan N-monooxygenase 2 OS=Arabidopsis thaliana GN=CYP79B3 PE=1 SV=1 | 253 | 474 | 1.0E-12 |
sp|O65787|C71B6_ARATH | Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 | 253 | 480 | 1.0E-12 |
sp|P15539|C11B2_MOUSE | Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 | 302 | 479 | 1.0E-12 |
sp|Q9N0U7|CP17A_CAPHI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 | 8 | 480 | 1.0E-12 |
sp|Q9LTM6|C71BH_ARATH | Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 | 123 | 485 | 1.0E-12 |
sp|Q8HYN1|CP17A_PANTR | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 | 304 | 511 | 1.0E-12 |
sp|Q9GMC8|CP17A_FELCA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 | 20 | 480 | 1.0E-12 |
sp|Q42798|C93A1_SOYBN | 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 | 301 | 496 | 1.0E-12 |
sp|P05093|CP17A_HUMAN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 | 304 | 511 | 1.0E-12 |
sp|Q9V4T3|C4AD1_DROME | Probable cytochrome P450 4ad1 OS=Drosophila melanogaster GN=Cyp4ad1 PE=2 SV=1 | 286 | 489 | 1.0E-12 |
sp|P37120|C75A2_SOLME | Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 | 265 | 487 | 1.0E-12 |
sp|Q1ZXF5|C5084_DICDI | Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 | 304 | 484 | 2.0E-12 |
sp|Q9VVN6|CP312_DROME | Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 | 273 | 474 | 2.0E-12 |
sp|Q9VUF8|CP314_DROME | Ecdysone 20-monooxygenase OS=Drosophila melanogaster GN=shd PE=1 SV=3 | 301 | 479 | 2.0E-12 |
sp|B9DFU2|MAX1_ARATH | Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 | 267 | 488 | 2.0E-12 |
sp|Q9XHC6|C93E1_SOYBN | Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 | 261 | 478 | 2.0E-12 |
sp|D5J9U8|GAO_LACSA | Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 | 304 | 511 | 2.0E-12 |
sp|Q9LUC6|C7A14_ARATH | Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 | 78 | 474 | 2.0E-12 |
sp|Q69X58|C76M7_ORYSJ | Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 | 303 | 480 | 2.0E-12 |
sp|Q556M4|C5082_DICDI | Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 | 24 | 484 | 2.0E-12 |
sp|Q43078|C97B1_PEA | Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 | 301 | 471 | 3.0E-12 |
sp|Q9LUC5|C7A15_ARATH | Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 | 67 | 474 | 3.0E-12 |
sp|P48419|C75A3_PETHY | Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 | 266 | 480 | 3.0E-12 |
sp|Q9LW27|C71BF_ARATH | Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 | 258 | 478 | 3.0E-12 |
sp|P30609|CP52G_CANTR | Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 | 273 | 478 | 4.0E-12 |
sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 271 | 492 | 4.0E-12 |
sp|Q8HYN0|CP17A_PAPCY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 | 35 | 516 | 4.0E-12 |
sp|Q9VS79|CP4D8_DROME | Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 | 286 | 479 | 4.0E-12 |
sp|P9WPN1|C135A_MYCTU | Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135A1 PE=1 SV=1 | 40 | 465 | 5.0E-12 |
sp|P9WPN0|C135A_MYCTO | Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135A1 PE=3 SV=1 | 40 | 465 | 5.0E-12 |
sp|Q964T2|CP9E2_BLAGE | Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 | 188 | 480 | 5.0E-12 |
sp|Q27593|CP6A8_DROME | Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 | 266 | 489 | 5.0E-12 |
sp|Q4G0S4|C27C1_HUMAN | Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 | 286 | 480 | 7.0E-12 |
sp|D5JBX0|GAO_HELAN | Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 | 304 | 511 | 7.0E-12 |
sp|Q7X7X4|C99A2_ORYSJ | Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 | 301 | 485 | 8.0E-12 |
sp|P97720|C11B1_MESAU | Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 | 298 | 474 | 9.0E-12 |
sp|E1B2Z9|C7AV8_CICIN | Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 | 304 | 484 | 9.0E-12 |
sp|P56656|CP239_MOUSE | Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 | 249 | 487 | 1.0E-11 |
sp|P33270|CP6A2_DROME | Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 | 188 | 474 | 1.0E-11 |
sp|P9WPM5|CP137_MYCTU | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 | 59 | 470 | 1.0E-11 |
sp|P9WPM4|CP137_MYCTO | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 | 59 | 470 | 1.0E-11 |
sp|Q9LUC8|C7A13_ARATH | Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 | 78 | 476 | 1.0E-11 |
sp|Q27516|C13A8_CAEEL | Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 | 289 | 477 | 1.0E-11 |
sp|D5JBW9|GAO_SAUCO | Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 | 304 | 484 | 1.0E-11 |
sp|P36423|THAS_MOUSE | Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 | 181 | 477 | 1.0E-11 |
sp|Q8HYM9|CP17A_MACMU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 | 35 | 516 | 1.0E-11 |
sp|Q2XVA1|CP17A_MACFA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 | 35 | 516 | 1.0E-11 |
sp|O48923|C71DA_SOYBN | Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 | 301 | 480 | 1.0E-11 |
sp|O44221|CP4E5_DROMT | Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 | 286 | 483 | 1.0E-11 |
sp|Q12587|CP52Q_CANMA | Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 | 263 | 477 | 1.0E-11 |
sp|Q29497|CP17A_SHEEP | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 | 58 | 480 | 1.0E-11 |
sp|P37117|C71A4_SOLME | Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 | 304 | 478 | 1.0E-11 |
sp|P30610|CP52H_CANTR | Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 | 301 | 478 | 1.0E-11 |
sp|P47787|THAS_PIG | Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 | 130 | 474 | 2.0E-11 |
sp|P30100|C11B3_RAT | Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 | 298 | 465 | 2.0E-11 |
sp|C0SJS4|C71AJ_APIGR | Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 | 255 | 478 | 2.0E-11 |
sp|Q9V6H1|CP9H1_DROME | Probable cytochrome P450 9h1 OS=Drosophila melanogaster GN=Cyp9h1 PE=3 SV=1 | 130 | 474 | 2.0E-11 |
sp|Q64658|C11B2_MESAU | Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 | 302 | 474 | 2.0E-11 |
sp|P9WPN3|CP132_MYCTU | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 | 263 | 471 | 2.0E-11 |
sp|D5JBX1|GAO_BARSP | Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 | 304 | 484 | 2.0E-11 |
sp|P9WPN2|CP132_MYCTO | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 | 263 | 471 | 2.0E-11 |
sp|P59954|CP132_MYCBO | Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 | 263 | 471 | 2.0E-11 |
sp|Q9NGX9|CP302_DROME | Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 | 185 | 466 | 2.0E-11 |
sp|Q9VMS9|C4AC1_DROME | Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 | 294 | 487 | 2.0E-11 |
sp|Q1ZXL7|C5083_DICDI | Probable cytochrome P450 508A3 OS=Dictyostelium discoideum GN=cyp508A3-1 PE=3 SV=1 | 299 | 474 | 2.0E-11 |
sp|Q64410|CP17A_CAVPO | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 | 59 | 489 | 2.0E-11 |
sp|P30099|C11B2_RAT | Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 | 302 | 465 | 2.0E-11 |
sp|Q9V771|C6A23_DROME | Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 | 125 | 471 | 2.0E-11 |
sp|Q9VMS7|C4AC3_DROME | Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 | 297 | 487 | 3.0E-11 |
sp|Q54SN0|C513E_DICDI | Probable cytochrome P450 513E1 OS=Dictyostelium discoideum GN=cyp513E1 PE=3 SV=1 | 301 | 479 | 3.0E-11 |
sp|Q9VB31|C6A18_DROME | Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 | 177 | 488 | 3.0E-11 |
sp|B1NF20|C719E_ARGME | Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 | 305 | 475 | 3.0E-11 |
sp|Q9VRI9|CP6T1_DROME | Probable cytochrome P450 6t1 OS=Drosophila melanogaster GN=Cyp6t1 PE=2 SV=1 | 182 | 474 | 3.0E-11 |
sp|H2DH24|C7D47_PANGI | Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 | 260 | 475 | 3.0E-11 |
sp|O17624|C13B1_CAEEL | Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 | 260 | 483 | 3.0E-11 |
sp|Q9V558|CP4P1_DROME | Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 | 297 | 483 | 3.0E-11 |
sp|O64638|C76C3_ARATH | Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 | 301 | 485 | 3.0E-11 |
sp|Q964R1|CP6J1_BLAGE | Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 | 174 | 474 | 3.0E-11 |
sp|O65786|C71B4_ARATH | Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 | 304 | 478 | 4.0E-11 |
sp|H1A988|C7254_GLYUR | 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 | 263 | 474 | 4.0E-11 |
sp|Q9GLD2|CP17A_PAPHU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 | 35 | 516 | 4.0E-11 |
sp|Q9SBQ9|F3PH_PETHY | Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 | 130 | 474 | 4.0E-11 |
sp|O49396|C82C3_ARATH | Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 | 301 | 483 | 4.0E-11 |
sp|Q9FLC8|C79A2_ARATH | Phenylalanine N-monooxygenase OS=Arabidopsis thaliana GN=CYP79A2 PE=1 SV=1 | 265 | 495 | 4.0E-11 |
sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 242 | 487 | 4.0E-11 |
sp|G4XV71|C93C2_GLYUR | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 | 304 | 479 | 4.0E-11 |
sp|Q6Z5I7|C76M6_ORYSJ | Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 | 304 | 480 | 4.0E-11 |
sp|Q6YTF1|C76M8_ORYSJ | Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 | 303 | 478 | 4.0E-11 |
sp|Q92045|CP11A_DASAM | Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 | 302 | 474 | 5.0E-11 |
sp|Q8VWZ7|C76B6_CATRO | Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 | 301 | 485 | 5.0E-11 |
sp|I7CT85|C7A53_PANGI | Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 | 301 | 466 | 5.0E-11 |
sp|P05179|CP2C7_RAT | Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 | 223 | 487 | 5.0E-11 |
sp|P11715|CP17A_RAT | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 | 279 | 479 | 5.0E-11 |
sp|Q95328|CP17A_HORSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 | 32 | 511 | 6.0E-11 |
sp|Q9LHA1|C8D11_ARATH | Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 | 300 | 482 | 6.0E-11 |
sp|Q9VMS8|C4AC2_DROME | Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 | 294 | 487 | 7.0E-11 |
sp|Q42799|C93A2_SOYBN | Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 | 301 | 496 | 7.0E-11 |
sp|Q9W130|CP9C1_DROME | Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 | 3 | 480 | 7.0E-11 |
sp|Q9GMC7|CP17A_BISBI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 | 304 | 480 | 7.0E-11 |
sp|P15150|C11B1_BOVIN | Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 | 302 | 474 | 7.0E-11 |
sp|P15393|C11B1_RAT | Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 | 298 | 465 | 7.0E-11 |
sp|D1MI46|C76BA_SWEMU | Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 | 301 | 485 | 7.0E-11 |
sp|P27786|CP17A_MOUSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 | 278 | 478 | 8.0E-11 |
sp|L7X0L7|P6H_PAPSO | Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 | 301 | 486 | 9.0E-11 |
sp|Q9VMT6|C28D2_DROME | Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 | 267 | 480 | 9.0E-11 |
sp|P48422|C86A1_ARATH | Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 | 103 | 477 | 1.0E-10 |
sp|P48418|C75A1_PETHY | Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 | 266 | 480 | 1.0E-10 |
sp|P9WPM1|CP139_MYCTU | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 | 284 | 472 | 1.0E-10 |
sp|P9WPM0|CP139_MYCTO | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 | 284 | 472 | 1.0E-10 |
sp|P63720|CP139_MYCBO | Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 | 284 | 472 | 1.0E-10 |
sp|P0DKI7|STORR_PAPSO | Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 | 261 | 487 | 1.0E-10 |
sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 285 | 479 | 1.0E-10 |
sp|O65782|C83B1_ARATH | Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 | 301 | 498 | 1.0E-10 |
sp|Q9M7B7|C79D2_MANES | Valine N-monooxygenase 2 OS=Manihot esculenta GN=CYP79D2 PE=1 SV=1 | 265 | 477 | 1.0E-10 |
sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 301 | 480 | 1.0E-10 |
sp|A6YIH8|C7D55_HYOMU | Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 | 304 | 486 | 1.0E-10 |
sp|O15528|CP27B_HUMAN | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 | 296 | 484 | 2.0E-10 |
sp|Q9VMT5|C28D1_DROME | Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 | 270 | 480 | 2.0E-10 |
sp|Q29552|C11B1_PIG | Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 | 302 | 474 | 2.0E-10 |
sp|Q43255|C71C2_MAIZE | indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 | 267 | 478 | 2.0E-10 |
sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 250 | 485 | 2.0E-10 |
sp|Q27698|CP6D1_MUSDO | Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 | 171 | 480 | 2.0E-10 |
sp|O81117|C94A1_VICSA | Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 | 301 | 471 | 2.0E-10 |
sp|Q12585|CP52T_CANMA | Cytochrome P450 52D1 OS=Candida maltosa GN=CYP52D1 PE=2 SV=1 | 185 | 477 | 2.0E-10 |
sp|A3A871|C71Z6_ORYSJ | Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 | 301 | 485 | 2.0E-10 |
sp|P48416|CP10_LYMST | Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 | 288 | 474 | 2.0E-10 |
sp|P05185|CP17A_BOVIN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 | 304 | 480 | 2.0E-10 |
sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 304 | 478 | 2.0E-10 |
sp|P49430|THAS_RAT | Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 | 285 | 477 | 2.0E-10 |
sp|Q6TBX7|LUT1_ARATH | Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 | 301 | 471 | 3.0E-10 |
sp|P24557|THAS_HUMAN | Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 | 181 | 477 | 3.0E-10 |
sp|P70085|CP17A_ORYLA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 | 270 | 479 | 3.0E-10 |
sp|Q92104|CP11B_LITCT | Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 | 301 | 486 | 3.0E-10 |
sp|Q6XQ14|C71E7_MANES | 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 | 55 | 478 | 3.0E-10 |
sp|H1A981|C7263_MEDTR | 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 | 126 | 474 | 4.0E-10 |
sp|B1NF18|C719B_PAPSO | Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 | 130 | 471 | 4.0E-10 |
sp|Q9Y8G7|C505_FUSOX | Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 | 268 | 465 | 4.0E-10 |
sp|O49394|C82C2_ARATH | Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 | 301 | 480 | 4.0E-10 |
sp|O04164|C71A6_NEPRA | Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 | 301 | 485 | 4.0E-10 |
sp|O64635|C76C4_ARATH | Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 | 301 | 485 | 4.0E-10 |
sp|P13527|CP6A1_MUSDO | Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 | 177 | 483 | 4.0E-10 |
sp|Q9SXS3|C93C2_GLYEC | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 | 304 | 479 | 4.0E-10 |
sp|Q9LTM2|C71BL_ARATH | Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 | 40 | 485 | 5.0E-10 |
sp|O64637|C76C2_ARATH | Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 | 250 | 496 | 5.0E-10 |
sp|Q54CS3|C508C_DICDI | Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 | 301 | 480 | 6.0E-10 |
sp|Q54ZM4|C518A_DICDI | Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518A1 PE=3 SV=1 | 299 | 472 | 6.0E-10 |
sp|Q9T0K0|C71AJ_ARATH | Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 | 301 | 495 | 6.0E-10 |
sp|Q54KV0|C513B_DICDI | Probable cytochrome P450 513B1 OS=Dictyostelium discoideum GN=cyp513B1 PE=3 SV=1 | 24 | 489 | 6.0E-10 |
sp|Q9STK7|C71AQ_ARATH | Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 | 269 | 483 | 6.0E-10 |
sp|Q9LTM1|C71BM_ARATH | Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1 | 183 | 478 | 6.0E-10 |
sp|P51663|C11B1_SHEEP | Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 | 302 | 474 | 6.0E-10 |
sp|Q9XHE8|C71DI_MENSP | Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 | 304 | 487 | 7.0E-10 |
sp|Q6WKZ1|C71DI_MENGR | Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 | 304 | 487 | 7.0E-10 |
sp|P33263|CP2CQ_MESAU | Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 | 248 | 487 | 7.0E-10 |
sp|Q9M7B8|C79D1_MANES | Valine N-monooxygenase 1 OS=Manihot esculenta GN=CYP79D1 PE=1 SV=1 | 253 | 477 | 7.0E-10 |
sp|Q94FM7|C71DK_TOBAC | 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 | 304 | 485 | 8.0E-10 |
sp|O08394|CYPD_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 | 258 | 479 | 9.0E-10 |
sp|O08336|CYPB_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 | 55 | 486 | 9.0E-10 |
sp|L7X3S1|MSH_PAPSO | Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 | 137 | 479 | 9.0E-10 |
sp|Q1ZXI7|C513F_DICDI | Probable cytochrome P450 513F1 OS=Dictyostelium discoideum GN=cyp513F1 PE=3 SV=1 | 301 | 477 | 9.0E-10 |
sp|Q9V676|CP6T3_DROME | Probable cytochrome P450 6t3 OS=Drosophila melanogaster GN=Cyp6t3 PE=3 SV=1 | 109 | 477 | 9.0E-10 |
sp|C0SJS3|ANGS_PASSA | Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 | 272 | 484 | 1.0E-09 |
sp|P58046|C71AF_ARATH | Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 | 301 | 480 | 1.0E-09 |
sp|Q9VYT8|C28C1_DROME | Probable cytochrome P450 28c1 OS=Drosophila melanogaster GN=Cyp28c1 PE=2 SV=1 | 261 | 458 | 1.0E-09 |
sp|H2DH21|C7A29_PANGI | Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 | 265 | 474 | 1.0E-09 |
sp|Q9FVS9|C96AF_ARATH | Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 | 301 | 484 | 1.0E-09 |
sp|P33264|CP2CR_MESAU | Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 | 248 | 487 | 1.0E-09 |
sp|O35132|CP27B_RAT | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 | 290 | 479 | 1.0E-09 |
sp|Q9V674|CP6G1_DROME | Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 | 294 | 480 | 1.0E-09 |
sp|Q6QNI4|C71AJ_AMMMJ | Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 | 272 | 462 | 1.0E-09 |
sp|Q96418|C75A5_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 | 174 | 478 | 1.0E-09 |
sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 252 | 488 | 1.0E-09 |
sp|Q9LMM1|C86A4_ARATH | Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 | 122 | 474 | 1.0E-09 |
sp|P47195|C80A1_BERST | Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 | 305 | 496 | 2.0E-09 |
sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 252 | 488 | 2.0E-09 |
sp|Q2PG45|THAS_MACFA | Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 | 293 | 480 | 2.0E-09 |
sp|P93147|C81E1_GLYEC | Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 | 301 | 484 | 2.0E-09 |
sp|Q9LTL0|C71BQ_ARATH | Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 | 61 | 485 | 2.0E-09 |
sp|O65012|C78A4_PINRA | Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 | 301 | 478 | 2.0E-09 |
sp|Q9UVC3|CP51_CUNEL | Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 | 248 | 478 | 2.0E-09 |
sp|Q9VG82|CP9F2_DROME | Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1 | 130 | 477 | 3.0E-09 |
sp|Q29527|C11B1_PAPHU | Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 | 291 | 459 | 3.0E-09 |
sp|Q6IV13|C7D95_MENSP | Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 | 304 | 485 | 3.0E-09 |
sp|Q6R7M4|C15A1_DIPPU | Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 | 269 | 479 | 3.0E-09 |
sp|C0SJS2|C71AJ_PASSA | Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 | 252 | 462 | 3.0E-09 |
sp|Q6WKY9|C7D95_MENGR | Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 | 304 | 485 | 3.0E-09 |
sp|Q9LTM3|C71BK_ARATH | Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 | 301 | 485 | 3.0E-09 |
sp|O23066|C86A2_ARATH | Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 | 301 | 484 | 3.0E-09 |
sp|P93149|C93B1_GLYEC | Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 | 304 | 478 | 3.0E-09 |
sp|Q07217|CP11A_ONCMY | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 | 301 | 485 | 3.0E-09 |
sp|Q92148|CP1A1_MICTO | Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 | 242 | 471 | 3.0E-09 |
sp|Q42569|C90A1_ARATH | Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1 | 272 | 472 | 4.0E-09 |
sp|O65790|C81F1_ARATH | Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 | 172 | 484 | 4.0E-09 |
sp|Q96581|C75A4_GENTR | Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 | 266 | 487 | 4.0E-09 |
sp|Q64458|CP2CT_MOUSE | Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 | 253 | 483 | 4.0E-09 |
sp|I3PFJ5|C76AD_BETVU | Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 | 287 | 462 | 4.0E-09 |
sp|Q6J541|C79D3_LOTJA | Isoleucine N-monooxygenase 1 OS=Lotus japonicus GN=CYP79D3 PE=1 SV=1 | 265 | 475 | 5.0E-09 |
sp|Q1ZXG6|C5131_DICDI | Probable cytochrome P450 513A1 OS=Dictyostelium discoideum GN=cyp513A1 PE=3 SV=1 | 304 | 478 | 5.0E-09 |
sp|P30611|CP52N_CANTR | Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 | 301 | 478 | 5.0E-09 |
sp|P70687|CP17A_MESAU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 | 304 | 479 | 5.0E-09 |
sp|Q27515|C13A6_CAEEL | Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 | 293 | 488 | 6.0E-09 |
sp|Q50EK1|C16B1_PICSI | Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 | 265 | 526 | 6.0E-09 |
sp|Q9XHE7|C71DD_MENPI | Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 | 304 | 486 | 6.0E-09 |
sp|O49340|C71AC_ARATH | Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 | 301 | 484 | 6.0E-09 |
sp|Q9V675|CP6G2_DROME | Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 | 294 | 474 | 6.0E-09 |
sp|O65438|C71AR_ARATH | Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 | 301 | 484 | 7.0E-09 |
sp|P15538|C11B1_HUMAN | Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 | 291 | 459 | 8.0E-09 |
sp|Q6WNR0|C81E7_MEDTR | Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 | 290 | 481 | 8.0E-09 |
sp|Q96SQ9|CP2S1_HUMAN | Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 | 265 | 488 | 8.0E-09 |
sp|P33261|CP2CJ_HUMAN | Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 | 223 | 487 | 8.0E-09 |
sp|Q29510|CP2CU_RABIT | Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 | 251 | 487 | 8.0E-09 |
sp|Q9LTM4|C71BJ_ARATH | Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 | 301 | 485 | 8.0E-09 |
sp|O81973|C93A3_SOYBN | Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 | 301 | 480 | 8.0E-09 |
sp|P24465|C71A1_PERAE | Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 | 266 | 485 | 8.0E-09 |
sp|O22203|C98A3_ARATH | Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 | 177 | 477 | 9.0E-09 |
sp|Q9QUJ1|CP2DS_MESAU | Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 | 143 | 466 | 9.0E-09 |
sp|P19099|C11B2_HUMAN | Cytochrome P450 11B2, mitochondrial OS=Homo sapiens GN=CYP11B2 PE=1 SV=3 | 302 | 459 | 9.0E-09 |
sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 285 | 482 | 1.0E-08 |
sp|Q43257|C71C4_MAIZE | indole-2-monooxygenase OS=Zea mays GN=CYP71C4 PE=1 SV=1 | 266 | 485 | 1.0E-08 |
sp|Q9LXM3|C71BZ_ARATH | Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=CYP71B38 PE=2 SV=2 | 189 | 478 | 1.0E-08 |
sp|Q9SCN2|C71BU_ARATH | Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 | 301 | 478 | 1.0E-08 |
sp|Q9VGH1|CP315_DROME | Cytochrome P450 315a1, mitochondrial OS=Drosophila melanogaster GN=sad PE=2 SV=1 | 301 | 479 | 1.0E-08 |
sp|Q08078|CP2CP_MESAU | Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 | 248 | 487 | 1.0E-08 |
sp|Q95078|CP18A_DROME | Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 | 129 | 479 | 1.0E-08 |
sp|Q7Y1V5|C78AB_ORYSJ | Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 | 301 | 478 | 1.0E-08 |
sp|P56655|CP238_MOUSE | Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 | 253 | 487 | 1.0E-08 |
sp|P93530|C71D6_SOLCH | Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 | 304 | 486 | 1.0E-08 |
sp|P93531|C71D7_SOLCH | Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 | 301 | 486 | 1.0E-08 |
sp|P9WPM9|C135B_MYCTU | Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135B1 PE=1 SV=1 | 256 | 479 | 1.0E-08 |
sp|P9WPM8|C135B_MYCTO | Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135B1 PE=3 SV=1 | 256 | 479 | 1.0E-08 |
sp|P63716|C135B_MYCBO | Putative cytochrome P450 135B1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp135B1 PE=3 SV=1 | 256 | 479 | 1.0E-08 |
sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 276 | 502 | 1.0E-08 |
sp|P79402|CP242_PIG | Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 | 241 | 487 | 1.0E-08 |
sp|Q6J540|C79D4_LOTJA | Isoleucine N-monooxygenase 2 OS=Lotus japonicus GN=CYP79D4 PE=1 SV=1 | 265 | 475 | 2.0E-08 |
sp|Q9SLP1|C78A9_ARATH | Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 | 134 | 478 | 2.0E-08 |
sp|Q50EK0|C16B2_PICSI | Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1 | 265 | 527 | 2.0E-08 |
sp|Q91Z85|CP17A_PERLE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 | 304 | 488 | 2.0E-08 |
sp|B3RFJ6|86A22_PETHY | Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 | 129 | 484 | 2.0E-08 |
sp|Q9LUC9|C7A11_ARATH | Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 | 261 | 474 | 2.0E-08 |
sp|P56654|CP237_MOUSE | Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 | 252 | 487 | 2.0E-08 |
sp|Q9XHE6|C71DF_MENPI | Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 | 304 | 485 | 2.0E-08 |
sp|Q9YH64|CP1A1_PLAFE | Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 | 248 | 471 | 2.0E-08 |
sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 269 | 466 | 3.0E-08 |
sp|P98183|C71DC_CATRO | Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 | 304 | 478 | 3.0E-08 |
sp|P12394|CP17A_CHICK | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 | 62 | 479 | 3.0E-08 |
sp|O48957|C99A1_SORBI | Cytochrome P450 CYP99A1 (Fragment) OS=Sorghum bicolor GN=CYP99A1 PE=2 SV=1 | 249 | 478 | 3.0E-08 |
sp|Q12573|CP52W_CANAP | Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 | 250 | 472 | 3.0E-08 |
sp|P58047|C71AS_ARATH | Putative cytochrome P450 71A28 OS=Arabidopsis thaliana GN=CYP71A28 PE=3 SV=2 | 175 | 487 | 4.0E-08 |
sp|O65784|C71B5_ARATH | Cytochrome P450 71B5 OS=Arabidopsis thaliana GN=CYP71B5 PE=2 SV=1 | 173 | 478 | 4.0E-08 |
sp|Q9ZNR0|C78A6_ARATH | Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 | 271 | 506 | 4.0E-08 |
sp|Q4PJW3|CP51A_BOVIN | Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 | 258 | 478 | 4.0E-08 |
sp|Q9M066|C90C1_ARATH | 3-epi-6-deoxocathasterone 23-monooxygenase OS=Arabidopsis thaliana GN=ROT3 PE=2 SV=3 | 301 | 477 | 5.0E-08 |
sp|Q9VQD2|CP391_DROME | Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 | 265 | 481 | 5.0E-08 |
sp|Q9FIB0|C78A7_ARATH | Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 | 301 | 478 | 5.0E-08 |
sp|O42430|CP1A1_LIMLI | Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 | 248 | 471 | 5.0E-08 |
sp|P20813|CP2B6_HUMAN | Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 | 250 | 487 | 5.0E-08 |
sp|P33262|CP2CK_MACFA | Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 | 223 | 480 | 5.0E-08 |
sp|Q9C788|C70B1_ARATH | Cytochrome P450 704B1 OS=Arabidopsis thaliana GN=CYP704B1 PE=1 SV=1 | 301 | 471 | 5.0E-08 |
sp|Q06367|CP1A1_CAVPO | Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 | 249 | 485 | 6.0E-08 |
sp|P33267|CP2F2_MOUSE | Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 | 289 | 487 | 6.0E-08 |
sp|Q6WNQ8|C81E8_MEDTR | Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 | 300 | 481 | 7.0E-08 |
sp|Q16850|CP51A_HUMAN | Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 | 258 | 478 | 7.0E-08 |
sp|P33260|CP2CI_HUMAN | Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 | 248 | 487 | 7.0E-08 |
sp|Q6YV88|C71Z7_ORYSJ | Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 | 305 | 485 | 8.0E-08 |
sp|Q9V776|CP317_DROME | Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 | 272 | 458 | 8.0E-08 |
sp|Q55BU9|C5133_DICDI | Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 | 38 | 478 | 9.0E-08 |
sp|Q5IZM4|CP51_MYCVP | Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 | 271 | 482 | 9.0E-08 |
sp|P14137|CP11A_RAT | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 | 301 | 474 | 9.0E-08 |
sp|Q9CA60|C98A9_ARATH | Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 | 174 | 477 | 1.0E-07 |
sp|P10632|CP2C8_HUMAN | Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 | 223 | 487 | 1.0E-07 |
sp|P11371|CP2C4_RABIT | Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 | 240 | 487 | 1.0E-07 |
sp|P03940|CP21A_MOUSE | Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 | 154 | 479 | 1.0E-07 |
sp|Q9VRB3|CP6V1_DROME | Probable cytochrome P450 6v1 OS=Drosophila melanogaster GN=Cyp6v1 PE=2 SV=1 | 303 | 475 | 1.0E-07 |
sp|Q92095|CP1A1_OPSTA | Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 | 188 | 471 | 1.0E-07 |
sp|Q82IY3|PTLI_STRAW | Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 | 266 | 474 | 2.0E-07 |
sp|P33266|CP2E1_MACFA | Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 | 301 | 487 | 2.0E-07 |
sp|P37121|C76A1_SOLME | Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 | 243 | 478 | 2.0E-07 |
sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 301 | 499 | 2.0E-07 |
sp|Q9VG40|CP134_DROME | Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 | 289 | 487 | 2.0E-07 |
sp|P04798|CP1A1_HUMAN | Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 | 249 | 485 | 2.0E-07 |
sp|O04790|C75A7_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 | 174 | 477 | 2.0E-07 |
sp|Q2KIG5|THAS_BOVIN | Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 | 130 | 458 | 2.0E-07 |
sp|Q92100|CP1A1_PLEPL | Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 | 282 | 471 | 2.0E-07 |
sp|O46420|CP51A_PIG | Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 | 286 | 478 | 2.0E-07 |
sp|Q9SAB6|C71AI_ARATH | Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 | 301 | 478 | 2.0E-07 |
sp|Q8K0C4|CP51A_MOUSE | Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 | 286 | 478 | 2.0E-07 |
sp|C0SPF7|C15C1_BOMMO | Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 | 301 | 480 | 2.0E-07 |
sp|Q9VWR5|CP306_DROME | Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 | 304 | 490 | 2.0E-07 |
sp|P00179|CP2C5_RABIT | Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 | 257 | 487 | 2.0E-07 |
GO Term | Description | Terminal node |
---|---|---|
GO:0004497 | monooxygenase activity | Yes |
GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
GO:0005506 | iron ion binding | Yes |
GO:0020037 | heme binding | Yes |
GO:0016491 | oxidoreductase activity | No |
GO:0046906 | tetrapyrrole binding | No |
GO:0003824 | catalytic activity | No |
GO:0046872 | metal ion binding | No |
GO:0046914 | transition metal ion binding | No |
GO:0097159 | organic cyclic compound binding | No |
GO:0005488 | binding | No |
GO:0043167 | ion binding | No |
GO:1901363 | heterocyclic compound binding | No |
GO:0043169 | cation binding | No |
GO:0003674 | molecular_function | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 11 | 0.5 |
Domain # | Start | End | Length |
---|---|---|---|
1 | 7 | 29 | 22 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|6794 MDLDLGNLWAFLGLALGSAVLYALGIVVYRVFFHPLAKYPGPFLAKITDAYQTSHAYKGDRHLEFWRMHQKYGKV VRFGPNSLSFNSSQALKEIYGFRSNVRKAEFYDAFVHPAANTHNTRDKEVHARKRRVLSHAFSDSAIKEIQRYIL NNVRTFCEQIGLDDGAADAKGWTQPRNMSNWCSYLAMDILGDLSFGKAFHMLERPDNRFALELVEAATTRHLICG TMPIVDKLKIDKILFPKLAAGRARYMAYSKAQLTERTKLGEETDRRDFFYYLLKARDPETGQGFSTPELWGESNL LIIAGSDTTSTAMAATMFYLVRNPHALKRATDEIRAKFRNVEEVVHGPALGSCSYLRACIDEAMRLSPSVGGVLP REVLGGGMSIDGQAVAAGTVVGVAHYVIHHNEDYFPVPFGYAPERWLAGETNPLTGRATTDDDLAAAQSAFCPFS VGPRGCIGKGLAYVEMTTTLARTLYLYDMRRAVGVDDPGEGRRDLEWGRHRPSEMQLIDTFTSSKKGTMIEFRRA DTS* |
Coding | >Hirsu2|6794 ATGGATCTCGACCTGGGAAATCTATGGGCCTTCCTGGGCTTAGCCCTCGGGAGCGCCGTCCTCTACGCACTCGGC ATCGTCGTGTACAGGGTGTTCTTCCACCCGCTGGCCAAGTACCCGGGACCCTTCCTGGCCAAGATCACGGATGCG TACCAAACCAGCCACGCATACAAGGGCGACCGCCATCTGGAGTTCTGGCGCATGCACCAGAAATACGGCAAAGTC GTTCGCTTCGGCCCCAACTCGCTGTCCTTCAACTCGAGCCAGGCGCTCAAGGAGATCTACGGCTTCCGGTCCAAC GTCCGCAAGGCCGAGTTCTACGATGCCTTTGTTCACCCGGCCGCCAACACGCACAACACGCGCGACAAGGAGGTG CACGCGCGCAAGCGGCGCGTCCTCTCGCACGCCTTCTCCGACAGCGCCATCAAGGAGATTCAGCGGTACATCCTG AACAACGTGCGCACCTTTTGCGAGCAGATCGGCCTCGACGATGGCGCGGCCGACGCCAAGGGCTGGACGCAGCCG CGCAACATGAGCAACTGGTGCAGCTACCTGGCCATGGACATCCTGGGCGACCTGAGCTTCGGCAAGGCCTTCCAC ATGCTGGAGCGGCCGGACAACCGCTTCGCCCTGGAGCTGGTCGAGGCCGCCACGACCCGGCATCTCATCTGCGGC ACGATGCCCATCGTCGACAAGCTCAAGATTGACAAGATCCTGTTCCCCAAGCTGGCGGCCGGCCGTGCGCGCTAC ATGGCTTACAGCAAGGCCCAGCTGACGGAGCGCACCAAGCTCGGGGAGGAGACGGACCGCCGCGACTTTTTCTAC TACCTGCTCAAGGCTCGCGATCCCGAGACGGGCCAGGGCTTCAGCACGCCCGAGCTCTGGGGCGAGTCGAACCTG CTTATCATCGCCGGCTCGGACACGACGTCGACGGCCATGGCGGCGACCATGTTCTACCTGGTCCGCAACCCGCAC GCGCTGAAGCGGGCGACGGACGAGATCCGGGCCAAGTTCCGGAACGTCGAGGAGGTGGTCCACGGGCCGGCGCTG GGCAGCTGCAGCTACCTCCGGGCGTGCATCGACGAGGCGATGCGGCTGTCGCCGTCGGTCGGCGGCGTCCTGCCG CGCGAGGTGCTGGGCGGCGGCATGAGCATCGACGGACAGGCGGTGGCGGCCGGGACCGTCGTCGGCGTCGCGCAC TACGTCATCCACCACAACGAGGACTACTTCCCCGTGCCGTTCGGCTACGCGCCGGAGCGCTGGCTCGCGGGCGAG ACGAACCCGCTGACGGGCCGGGCGACGACCGACGACGACCTGGCCGCGGCCCAGAGCGCCTTCTGTCCCTTCAGC GTCGGGCCGCGCGGCTGCATCGGCAAGGGCCTGGCCTACGTCGAGATGACGACGACGCTGGCCCGCACCCTCTAC CTCTACGACATGCGCCGGGCCGTCGGCGTCGACGACCCGGGCGAGGGCCGCCGCGACCTCGAGTGGGGCCGCCAC CGGCCGAGCGAGATGCAGCTGATCGACACCTTCACCAGCTCCAAGAAGGGGACCATGATTGAGTTCCGCAGGGCC GACACGTCCTGA |
Transcript | >Hirsu2|6794 ATGGATCTCGACCTGGGAAATCTATGGGCCTTCCTGGGCTTAGCCCTCGGGAGCGCCGTCCTCTACGCACTCGGC ATCGTCGTGTACAGGGTGTTCTTCCACCCGCTGGCCAAGTACCCGGGACCCTTCCTGGCCAAGATCACGGATGCG TACCAAACCAGCCACGCATACAAGGGCGACCGCCATCTGGAGTTCTGGCGCATGCACCAGAAATACGGCAAAGTC GTTCGCTTCGGCCCCAACTCGCTGTCCTTCAACTCGAGCCAGGCGCTCAAGGAGATCTACGGCTTCCGGTCCAAC GTCCGCAAGGCCGAGTTCTACGATGCCTTTGTTCACCCGGCCGCCAACACGCACAACACGCGCGACAAGGAGGTG CACGCGCGCAAGCGGCGCGTCCTCTCGCACGCCTTCTCCGACAGCGCCATCAAGGAGATTCAGCGGTACATCCTG AACAACGTGCGCACCTTTTGCGAGCAGATCGGCCTCGACGATGGCGCGGCCGACGCCAAGGGCTGGACGCAGCCG CGCAACATGAGCAACTGGTGCAGCTACCTGGCCATGGACATCCTGGGCGACCTGAGCTTCGGCAAGGCCTTCCAC ATGCTGGAGCGGCCGGACAACCGCTTCGCCCTGGAGCTGGTCGAGGCCGCCACGACCCGGCATCTCATCTGCGGC ACGATGCCCATCGTCGACAAGCTCAAGATTGACAAGATCCTGTTCCCCAAGCTGGCGGCCGGCCGTGCGCGCTAC ATGGCTTACAGCAAGGCCCAGCTGACGGAGCGCACCAAGCTCGGGGAGGAGACGGACCGCCGCGACTTTTTCTAC TACCTGCTCAAGGCTCGCGATCCCGAGACGGGCCAGGGCTTCAGCACGCCCGAGCTCTGGGGCGAGTCGAACCTG CTTATCATCGCCGGCTCGGACACGACGTCGACGGCCATGGCGGCGACCATGTTCTACCTGGTCCGCAACCCGCAC GCGCTGAAGCGGGCGACGGACGAGATCCGGGCCAAGTTCCGGAACGTCGAGGAGGTGGTCCACGGGCCGGCGCTG GGCAGCTGCAGCTACCTCCGGGCGTGCATCGACGAGGCGATGCGGCTGTCGCCGTCGGTCGGCGGCGTCCTGCCG CGCGAGGTGCTGGGCGGCGGCATGAGCATCGACGGACAGGCGGTGGCGGCCGGGACCGTCGTCGGCGTCGCGCAC TACGTCATCCACCACAACGAGGACTACTTCCCCGTGCCGTTCGGCTACGCGCCGGAGCGCTGGCTCGCGGGCGAG ACGAACCCGCTGACGGGCCGGGCGACGACCGACGACGACCTGGCCGCGGCCCAGAGCGCCTTCTGTCCCTTCAGC GTCGGGCCGCGCGGCTGCATCGGCAAGGGCCTGGCCTACGTCGAGATGACGACGACGCTGGCCCGCACCCTCTAC CTCTACGACATGCGCCGGGCCGTCGGCGTCGACGACCCGGGCGAGGGCCGCCGCGACCTCGAGTGGGGCCGCCAC CGGCCGAGCGAGATGCAGCTGATCGACACCTTCACCAGCTCCAAGAAGGGGACCATGATTGAGTTCCGCAGGGCC GACACGTCCTGA |
Gene | >Hirsu2|6794 ATGGATCTCGACCTGGGAAATCTATGGGCCTTCCTGGGCTTAGCCCTCGGGAGCGCCGTCCTCTACGTATGTCGC TCGGACGGGCGACGTCGGGTGGCTGGAATGCGATGCTGACCGCCGCTCTCGTCTCCCACAGGCACTCGGCATCGT CGTGTACAGGGTGTTCTTCCACCCGCTGGCCAAGTACCCGGGACCCTTCCTGGCCAAGATCACGGATGCGTACCA AACCAGCCACGCATACAAGGGCGACCGCCATCTGGAGTTCTGGCGCATGCACCAGAAATACGGTGAGTCCCGGCC GGCCCACCGACGTCCTGCAAGGCGTGACAGAAGAGGCGAGGACGAAGGGGGAGCGCGCGGCGAGAAGACGACGAG AAAGGGACTCACTGACGGCGGGGACAATGCAGGCAAAGTCGTTCGCTTCGGCCCCAACTCGCTGTCCTTCAACTC GAGCCAGGCGCTCAAGGAGATCTACGGCTTCCGGTCCAACGTCCGCAAGGCCGAGTTCTACGATGCCTTTGTTCA CCCGGCCGCCAACACGCACAACACGCGCGACAAGGAGGTGCACGCGCGCAAGCGGCGCGTCCTCTCGCACGCCTT CTCCGACAGCGCCATCAAGGAGATTCAGCGGTACATCCTGAACAACGTGCGCACCTTTTGCGAGCAGATCGGCCT CGACGATGGCGCGGCCGACGCCAAGGGCTGGACGCAGCCGCGCAACATGAGCAACTGGTGCAGCTACCTGGCCAT GGACATCCTGGGCGACCTGAGCTTCGGCAAGGCCTTCCACATGCTGGAGCGGCCGGACAACCGCTTCGCCCTGGA GCTGGTCGAGGCCGCCACGACCCGGCATCTCATCGTGAGTGGTGGCCCCCCCCCCCCTCTCCCGTGGCGAGAGGC GAACCGACGAGCGAGCGTGAGCGCACGGGGAAGTCGGGAGAGTTGGGGAGAGGCGTGGGTGAAGTCGGCCTGCTG ACGGAGGCCGGGCAGTGCGGCACGATGCCCATCGTCGACAAGCTCAAGATTGACAAGATCCTGTTCCCCAAGCTG GCGGCCGGCCGTGCGCGCTACATGGCTTACAGCAAGGCCCAGCTGACGGAGCGCACCAAGCTCGGGGAGGAGACG GACCGCCGCGACTTTTTCTACTACCTGCTCAAGGCTCGCGATCCCGAGACGGGCCAGGGCTTCAGCACGCCCGAG CTCTGGGGCGAGTCGAACCTGCTGTAAGTTGCTTGCTCGGTCGTCTCGCGTGTGTGTGTATTGGTGCGGGCGGCG GCGGAAGCCAGACACGCAAGGACAAGATTGCTGAGTCGGGCCGACGGCTTATAGTATCATCGCCGGCTCGGACAC GACGTCGACGGCCATGGCGGCGACCATGTTCTACCTGGTCCGCAACCCGCACGCGCTGAAGCGGGCGACGGACGA GATCCGGGCCAAGTTCCGGAACGTCGAGGAGGTGGTCCACGGGCCGGCGCTGGGCAGCTGCAGCTACCTCCGGGC GTGCATCGACGAGGCGATGCGGCTGTCGCCGTCGGTCGGCGGCGTCCTGCCGCGCGAGGTGCTGGGCGGCGGCAT GAGCATCGACGGACAGGCGGTGGCGGCCGGGACCGTCGTCGGCGTCGCGCACTACGTCATCCACCACAACGAGGA CTACTTCCCCGTGCCGTTCGGCTACGCGCCGGAGCGCTGGCTCGCGGGCGAGACGAACCCGCTGACGGGCCGGGC GACGACCGACGACGACCTGGCCGCGGCCCAGAGCGCCTTCTGTCCCTTCAGCGTCGGGCCGCGCGGCTGCATCGG CAAGGGCCTGGCCTACGTCGAGATGACGACGACGCTGGCCCGCACCCTCTACCTCTACGACATGCGCCGGGCCGT CGGCGTCGACGACCCGGGCGAGGGCCGCCGCGACCTCGAGTGGGGCCGCCACCGGCCGAGCGAGATGCAGCTGAT CGACACCTTCACCAGCTCCAAGAAGGGGACCATGATTGAGTTCCGCAGGGCCGACACGTCCTGA |