Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6793
Gene name
LocationContig_363:7036..10368
Strand+
Gene length (bp)3332
Transcript length (bp)2880
Coding sequence length (bp)2880
Protein length (aa) 960

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10277 Frag1 Frag1/DRAM/Sfk1 family 1.7E-38 19 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25618|CWH43_YEAST Protein CWH43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH43 PE=1 SV=2 13 958 0.0E+00
sp|Q9HDZ2|CWH43_SCHPO Protein cwh43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwh43 PE=2 SV=2 14 959 0.0E+00
sp|Q9H720|PG2IP_HUMAN PGAP2-interacting protein OS=Homo sapiens GN=CWH43 PE=2 SV=2 282 958 3.0E-87
sp|Q91YL7|PG2IP_MOUSE PGAP2-interacting protein OS=Mus musculus GN=Cwh43 PE=1 SV=1 276 958 7.0E-84
sp|Q2ABP2|PGAP2_CRIGR Post-GPI attachment to proteins factor 2 OS=Cricetulus griseus GN=Pgap2 PE=2 SV=1 7 231 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25618|CWH43_YEAST Protein CWH43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH43 PE=1 SV=2 13 958 0.0E+00
sp|Q9HDZ2|CWH43_SCHPO Protein cwh43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwh43 PE=2 SV=2 14 959 0.0E+00
sp|Q9H720|PG2IP_HUMAN PGAP2-interacting protein OS=Homo sapiens GN=CWH43 PE=2 SV=2 282 958 3.0E-87
sp|Q91YL7|PG2IP_MOUSE PGAP2-interacting protein OS=Mus musculus GN=Cwh43 PE=1 SV=1 276 958 7.0E-84
sp|Q2ABP2|PGAP2_CRIGR Post-GPI attachment to proteins factor 2 OS=Cricetulus griseus GN=Pgap2 PE=2 SV=1 7 231 1.0E-12
sp|Q2ABP3|PGAP2_RAT Post-GPI attachment to proteins factor 2 OS=Rattus norvegicus GN=Pgap2 PE=2 SV=1 7 231 7.0E-12
sp|Q3TQR0|PGAP2_MOUSE Post-GPI attachment to proteins factor 2 OS=Mus musculus GN=Pgap2 PE=1 SV=2 7 231 9.0E-12
sp|Q9UHJ9|PGAP2_HUMAN Post-GPI attachment to proteins factor 2 OS=Homo sapiens GN=PGAP2 PE=1 SV=2 7 231 4.0E-11
sp|A6H7B8|PGAP2_BOVIN Post-GPI attachment to proteins factor 2 OS=Bos taurus GN=PGAP2 PE=2 SV=1 7 231 2.0E-10
sp|Q5M9A7|PGAP2_XENLA Post-GPI attachment to proteins factor 2 OS=Xenopus laevis GN=pgap2 PE=2 SV=1 7 231 2.0E-10
sp|Q9VWK6|PGP2L_DROME Post-GPI attachment to proteins factor 2-like OS=Drosophila melanogaster GN=CG7990 PE=2 SV=4 62 224 1.0E-08
sp|A8KBG2|PGAP2_XENTR Post-GPI attachment to proteins factor 2 OS=Xenopus tropicalis GN=pgap2 PE=2 SV=1 59 231 4.0E-08
sp|Q9VPT7|PGAP2_DROME Post-GPI attachment to proteins factor 2 OS=Drosophila melanogaster GN=CG3876 PE=2 SV=2 59 236 4.0E-07
sp|Q29M88|PGAP2_DROPS Post-GPI attachment to proteins factor 2 OS=Drosophila pseudoobscura pseudoobscura GN=GA17744 PE=3 SV=2 60 230 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 78 100 22
3 107 129 22
4 139 158 19
5 171 190 19
6 200 222 22
7 279 301 22
8 311 330 19
9 337 359 22
10 412 434 22
11 455 477 22
12 492 514 22
13 521 541 20
14 546 568 22
15 575 597 22
16 612 629 17
17 649 666 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6793
MAAKYKDKDGGVVLSFRGQWVSWAHTAVAYTAFLSALAVGVALHYRKIVQNEFYGYPDEWFPSVSATIGDRYPER
SFFMIFIAITSGPRFALVGLWYLMTRKPGSRLPGFVASMGLLRTLTCGGWTYITSTDDHDWHDILMISYIVATLP
WTTGCIALSPPNPQAIQYRKYLAGAFFGTLVPLIFFFIRHKVHRVAGAYTIYAFFEWALIIFDVAFDAVTAFDFQ
TFEVVIRDVKGSSQGENFSPVPSAVLEKEKDKVTGGVFALRFTWSEALDTAADVYHGFIFWSMLSGLGVLVWYFP
LWHMGISGFEAFVMVSASPALLVGPIRSAVMNNLRIVHLLSLSGVAAYLVVSPVWRLVTVGFAVAISTMGWVATL
YSESAHETRFESKLLGLMVGLILSSTAKFAWQTNNPIWPVLHAANGGWNATGLALGVLAALRFTRRAPLTGGSGS
GGNQGGSAVLAAFGIGGLFFGLHSLLSDTSTMILWVWEGYPIRGPYFSTHGWCTIAAMSVGLFLGISRPSLAGGW
PPYAVGTLGAILLTFTSHWSGYFGGLALGTYLTAVSVPLISTASKKSPAVTFGLGFFIYVFMVLFHVWVVAYAFV
PGGPLVREHTDWIMATMVGLLGAGVFNYNTSQPRRQQPRRPSASQHKKYFGLSTLIVNILFLCAAFKRFPTNDYK
PYHAEDRVMTAGIWTIHFSLDNDMWSSEYRMRDLIKELELDVVGLLESDLQRIIMGNRDTTQFLAEDLGMYVDYG
PGPNKHTWGSALLSKFPIVESKHHLLPSPVGELAPAIHATLDVYGQLVDVFVFHSGQEEDPEDRRLQTEYLSELM
GATSRPAVLLSYLVTRPLEGNYNTYVGAKSGMHDIDPTDWDRWCEYILYKGLKRVGYARVSRSTITDTELQVGKF
VIPHSPSESAQLDAQSAEQRNHQVQESEVPEGWRFPAMFRGNGVRGHRYHVFNEPRYFN*
Coding >Hirsu2|6793
ATGGCGGCCAAATACAAGGACAAGGACGGCGGCGTCGTCCTGAGCTTCCGTGGCCAGTGGGTGAGCTGGGCGCAT
ACGGCGGTTGCCTACACCGCTTTCCTGAGCGCCCTCGCGGTCGGCGTCGCCCTCCACTACCGCAAGATCGTCCAG
AACGAATTCTATGGCTACCCCGACGAGTGGTTCCCCTCCGTCTCGGCGACGATTGGCGACCGATATCCCGAGCGA
TCGTTTTTCATGATCTTCATCGCCATTACCTCGGGCCCTCGCTTTGCTCTCGTCGGCTTGTGGTATCTCATGACC
CGCAAGCCAGGCTCCCGGCTCCCCGGCTTTGTCGCCTCCATGGGTCTCCTGCGCACGCTGACATGCGGCGGCTGG
ACATACATCACATCGACCGACGACCACGACTGGCACGATATCCTGATGATTTCCTACATTGTTGCTACCCTGCCT
TGGACCACCGGCTGCATCGCCTTGAGCCCCCCGAACCCCCAAGCCATCCAGTACCGCAAGTATCTTGCCGGCGCC
TTCTTCGGCACTCTTGTTCCCCTGATCTTCTTCTTCATCCGGCACAAGGTCCATCGCGTTGCTGGAGCCTACACC
ATCTATGCCTTCTTTGAATGGGCGCTCATCATCTTTGACGTGGCATTTGACGCCGTCACAGCTTTCGACTTCCAA
ACGTTCGAAGTCGTAATCAGAGACGTCAAGGGATCGAGCCAGGGTGAGAACTTCTCGCCCGTGCCGTCTGCCGTC
CTGGAAAAGGAGAAGGACAAGGTCACCGGCGGCGTGTTTGCCCTCCGATTCACCTGGTCCGAGGCGCTAGACACG
GCGGCCGACGTCTACCATGGCTTCATCTTCTGGTCAATGCTGAGCGGTCTCGGCGTTCTTGTTTGGTACTTCCCC
CTCTGGCACATGGGCATATCTGGATTCGAGGCCTTTGTCATGGTTTCCGCCTCGCCGGCTCTCCTGGTCGGCCCC
ATTCGATCCGCTGTCATGAACAATCTTCGGATTGTTCACCTCCTGTCGCTTTCAGGCGTGGCCGCCTACTTAGTC
GTCAGTCCGGTCTGGCGGCTCGTCACCGTCGGCTTTGCAGTTGCTATCTCGACCATGGGCTGGGTGGCCACCCTT
TACTCCGAGTCCGCGCACGAGACCCGGTTCGAGTCCAAGCTGCTGGGTCTGATGGTCGGCTTGATCCTGTCATCG
ACGGCCAAATTTGCCTGGCAGACAAACAACCCCATATGGCCCGTCCTGCACGCTGCCAACGGTGGCTGGAATGCC
ACTGGCCTCGCCCTCGGAGTCTTGGCCGCACTGCGCTTCACCCGGAGAGCGCCCCTCACTGGCGGCTCCGGGTCA
GGAGGGAATCAAGGAGGGTCGGCAGTCCTCGCCGCCTTCGGCATCGGCGGTCTTTTCTTCGGGCTTCACTCGCTG
CTCTCCGACACCAGCACCATGATTCTGTGGGTGTGGGAAGGATACCCCATCCGCGGTCCCTACTTCTCGACTCAC
GGCTGGTGTACGATAGCCGCCATGTCGGTAGGCCTATTCCTCGGCATCTCCAGGCCCTCTCTCGCTGGCGGCTGG
CCGCCGTACGCCGTCGGCACACTTGGCGCCATTCTCCTGACCTTCACCAGCCATTGGTCGGGATACTTTGGCGGC
CTGGCCCTCGGAACGTATCTCACGGCCGTCTCCGTCCCCCTGATTTCCACGGCCTCCAAGAAGAGCCCCGCGGTG
ACGTTCGGCCTGGGATTTTTCATCTACGTCTTCATGGTTTTGTTCCACGTCTGGGTCGTCGCCTATGCATTTGTA
CCCGGCGGCCCTCTTGTACGTGAGCACACAGACTGGATCATGGCGACCATGGTGGGACTTCTTGGCGCCGGTGTC
TTCAACTACAACACGTCGCAGCCGCGACGACAACAGCCTCGTCGACCTTCGGCATCGCAGCACAAGAAATACTTT
GGCCTGTCCACACTCATCGTCAACATTCTCTTCTTGTGTGCGGCGTTCAAGCGCTTCCCGACAAACGACTACAAG
CCGTATCACGCCGAGGACCGCGTCATGACGGCGGGCATCTGGACCATTCACTTCTCCCTCGACAACGACATGTGG
TCCTCCGAGTACCGCATGCGCGACCTCATCAAGGAGCTGGAGCTGGACGTCGTTGGCCTCCTCGAGTCGGATCTG
CAGCGCATCATTATGGGCAACCGAGACACGACGCAGTTCCTAGCCGAAGATCTTGGCATGTACGTCGACTATGGG
CCTGGTCCTAACAAGCACACCTGGGGCTCCGCCCTCCTGTCCAAGTTCCCCATCGTGGAGTCGAAGCACCACCTC
CTTCCCAGCCCCGTTGGCGAGCTGGCTCCGGCCATCCATGCCACTCTAGACGTGTACGGCCAACTCGTCGACGTC
TTCGTCTTTCACTCGGGACAGGAAGAGGACCCGGAGGATCGGCGGCTGCAGACCGAATACCTATCGGAGCTCATG
GGGGCGACTTCCCGCCCGGCCGTGCTCCTCAGCTACCTGGTGACCAGGCCGCTCGAAGGCAACTACAACACGTAC
GTCGGAGCCAAGTCGGGCATGCACGACATCGACCCGACGGACTGGGACCGCTGGTGCGAGTACATCCTGTACAAG
GGTCTCAAACGCGTGGGCTACGCGCGCGTCAGCCGCAGCACCATCACCGACACGGAGCTACAGGTCGGCAAGTTT
GTCATTCCTCACTCGCCGTCCGAATCAGCCCAGCTGGACGCGCAGTCAGCAGAGCAGCGCAATCACCAGGTGCAG
GAGTCGGAGGTGCCCGAGGGATGGAGGTTCCCGGCCATGTTCCGAGGCAACGGCGTGAGGGGCCATCGCTACCAT
GTATTCAATGAGCCGCGCTACTTCAACTGA
Transcript >Hirsu2|6793
ATGGCGGCCAAATACAAGGACAAGGACGGCGGCGTCGTCCTGAGCTTCCGTGGCCAGTGGGTGAGCTGGGCGCAT
ACGGCGGTTGCCTACACCGCTTTCCTGAGCGCCCTCGCGGTCGGCGTCGCCCTCCACTACCGCAAGATCGTCCAG
AACGAATTCTATGGCTACCCCGACGAGTGGTTCCCCTCCGTCTCGGCGACGATTGGCGACCGATATCCCGAGCGA
TCGTTTTTCATGATCTTCATCGCCATTACCTCGGGCCCTCGCTTTGCTCTCGTCGGCTTGTGGTATCTCATGACC
CGCAAGCCAGGCTCCCGGCTCCCCGGCTTTGTCGCCTCCATGGGTCTCCTGCGCACGCTGACATGCGGCGGCTGG
ACATACATCACATCGACCGACGACCACGACTGGCACGATATCCTGATGATTTCCTACATTGTTGCTACCCTGCCT
TGGACCACCGGCTGCATCGCCTTGAGCCCCCCGAACCCCCAAGCCATCCAGTACCGCAAGTATCTTGCCGGCGCC
TTCTTCGGCACTCTTGTTCCCCTGATCTTCTTCTTCATCCGGCACAAGGTCCATCGCGTTGCTGGAGCCTACACC
ATCTATGCCTTCTTTGAATGGGCGCTCATCATCTTTGACGTGGCATTTGACGCCGTCACAGCTTTCGACTTCCAA
ACGTTCGAAGTCGTAATCAGAGACGTCAAGGGATCGAGCCAGGGTGAGAACTTCTCGCCCGTGCCGTCTGCCGTC
CTGGAAAAGGAGAAGGACAAGGTCACCGGCGGCGTGTTTGCCCTCCGATTCACCTGGTCCGAGGCGCTAGACACG
GCGGCCGACGTCTACCATGGCTTCATCTTCTGGTCAATGCTGAGCGGTCTCGGCGTTCTTGTTTGGTACTTCCCC
CTCTGGCACATGGGCATATCTGGATTCGAGGCCTTTGTCATGGTTTCCGCCTCGCCGGCTCTCCTGGTCGGCCCC
ATTCGATCCGCTGTCATGAACAATCTTCGGATTGTTCACCTCCTGTCGCTTTCAGGCGTGGCCGCCTACTTAGTC
GTCAGTCCGGTCTGGCGGCTCGTCACCGTCGGCTTTGCAGTTGCTATCTCGACCATGGGCTGGGTGGCCACCCTT
TACTCCGAGTCCGCGCACGAGACCCGGTTCGAGTCCAAGCTGCTGGGTCTGATGGTCGGCTTGATCCTGTCATCG
ACGGCCAAATTTGCCTGGCAGACAAACAACCCCATATGGCCCGTCCTGCACGCTGCCAACGGTGGCTGGAATGCC
ACTGGCCTCGCCCTCGGAGTCTTGGCCGCACTGCGCTTCACCCGGAGAGCGCCCCTCACTGGCGGCTCCGGGTCA
GGAGGGAATCAAGGAGGGTCGGCAGTCCTCGCCGCCTTCGGCATCGGCGGTCTTTTCTTCGGGCTTCACTCGCTG
CTCTCCGACACCAGCACCATGATTCTGTGGGTGTGGGAAGGATACCCCATCCGCGGTCCCTACTTCTCGACTCAC
GGCTGGTGTACGATAGCCGCCATGTCGGTAGGCCTATTCCTCGGCATCTCCAGGCCCTCTCTCGCTGGCGGCTGG
CCGCCGTACGCCGTCGGCACACTTGGCGCCATTCTCCTGACCTTCACCAGCCATTGGTCGGGATACTTTGGCGGC
CTGGCCCTCGGAACGTATCTCACGGCCGTCTCCGTCCCCCTGATTTCCACGGCCTCCAAGAAGAGCCCCGCGGTG
ACGTTCGGCCTGGGATTTTTCATCTACGTCTTCATGGTTTTGTTCCACGTCTGGGTCGTCGCCTATGCATTTGTA
CCCGGCGGCCCTCTTGTACGTGAGCACACAGACTGGATCATGGCGACCATGGTGGGACTTCTTGGCGCCGGTGTC
TTCAACTACAACACGTCGCAGCCGCGACGACAACAGCCTCGTCGACCTTCGGCATCGCAGCACAAGAAATACTTT
GGCCTGTCCACACTCATCGTCAACATTCTCTTCTTGTGTGCGGCGTTCAAGCGCTTCCCGACAAACGACTACAAG
CCGTATCACGCCGAGGACCGCGTCATGACGGCGGGCATCTGGACCATTCACTTCTCCCTCGACAACGACATGTGG
TCCTCCGAGTACCGCATGCGCGACCTCATCAAGGAGCTGGAGCTGGACGTCGTTGGCCTCCTCGAGTCGGATCTG
CAGCGCATCATTATGGGCAACCGAGACACGACGCAGTTCCTAGCCGAAGATCTTGGCATGTACGTCGACTATGGG
CCTGGTCCTAACAAGCACACCTGGGGCTCCGCCCTCCTGTCCAAGTTCCCCATCGTGGAGTCGAAGCACCACCTC
CTTCCCAGCCCCGTTGGCGAGCTGGCTCCGGCCATCCATGCCACTCTAGACGTGTACGGCCAACTCGTCGACGTC
TTCGTCTTTCACTCGGGACAGGAAGAGGACCCGGAGGATCGGCGGCTGCAGACCGAATACCTATCGGAGCTCATG
GGGGCGACTTCCCGCCCGGCCGTGCTCCTCAGCTACCTGGTGACCAGGCCGCTCGAAGGCAACTACAACACGTAC
GTCGGAGCCAAGTCGGGCATGCACGACATCGACCCGACGGACTGGGACCGCTGGTGCGAGTACATCCTGTACAAG
GGTCTCAAACGCGTGGGCTACGCGCGCGTCAGCCGCAGCACCATCACCGACACGGAGCTACAGGTCGGCAAGTTT
GTCATTCCTCACTCGCCGTCCGAATCAGCCCAGCTGGACGCGCAGTCAGCAGAGCAGCGCAATCACCAGGTGCAG
GAGTCGGAGGTGCCCGAGGGATGGAGGTTCCCGGCCATGTTCCGAGGCAACGGCGTGAGGGGCCATCGCTACCAT
GTATTCAATGAGCCGCGCTACTTCAACTGA
Gene >Hirsu2|6793
ATGGCGGCCAAATACAAGGACAAGGACGGCGGCGTCGTCCTGAGCTTCCGTGGCCAGTGGGTGAGCTGGGCGCAT
ACGGCGGTTGCCTACAGTGAGTCTCCGTACCTCTTCGCCCGCGACCAGGCTTGCTCCCAGGCGACTCGCGCTGAT
GGACGTCTGCATAGCCGCTTTCCTGAGCGCCCTCGCGGTCGGCGTCGCCCTCCACTACCGCAAGATCGTCCAGAA
CGAATTCTATGGCTACCCCGACGAGTGGTTCCCCTCCGTCTCGGCGACGATTGGCGACCGATATCCCGAGCGATC
GTTTTTCATGATCTTCATCGCCATTACCTCGGGTGCGACTCCTCTTTCGATCGATACGCTGGTCTTGGAGGCTGA
CAAGCGCAGGCCCTCGCTTTGCTCTCGTCGGCTTGTGGTATCTCATGACCCGCAAGCCAGGCTCCCGGCTCCCCG
GCTTTGTCGCCTCCATGGGTCTCCTGCGCACGCTGACATGCGGCGGCTGGACATACATCACATCGACCGACGACC
ACGACTGGCACGATATCCTGATGATTTCCTACATTGTTGCTACCCTGCCTTGGACCACCGGCTGCATCGCCTTGA
GCCCCCCGAACCCCCAAGCCATCCAGTACCGCAAGTATCTTGCCGGCGCCTTCTTCGGCACTCTTGTTCCCCTGA
TCTTCTTCTTCATCCGGCACAAGGTCCATCGCGTTGCTGGAGGTAACATTACCTGATCCGTTGACGCCTCGTGCT
ATTCATACTGACATCTTCAGCCTACACCATCTATGCCTTCTTTGAATGGGCGCTCATCATCTTTGACGTGGCATT
TGACGCCGTCACAGCTTTCGACTTCCAAACGTTCGAAGTCGTAATCAGAGACGTCAAGGGATCGAGCCAGGGGTA
CGTGCAATGGCTTCCAAGATAGTGCTGGCTTCTGCTCGAGTTGCGACCAATAAACTTGTTCCTTCGCCACCGTCT
CTAAGTCTCTGCTCGCAGTGAGAACTTCTCGCCCGTGCCGTCTGCCGTCCTGGAAAAGGAGTAAGTCCGCCTCGG
CCCGAACGAAAGGCGGTCGACTGATGGTGCTGCCAGGAAGGACAAGGTCACCGGCGGCGTGTTTGCCCTCCGATT
CACCTGGTCCGAGGCGCTAGACACGGCGGCCGACGTCTACCATGGCGTACGTTGACTGTCCCATCTGTCTCCTGG
ACCCGACGGCACAAGTCACGAAATCTCTGACACACGGGTAGTTCATCTTCTGGTCAATGCTGAGCGGTCTCGGCG
TTCTTGTTTGGTGTAAGTCCCTCGGCCTCGTTGCACGGCGAAACCAGCGTTGATGACCTTGATCATCAGACTTCC
CCCTCTGGCACATGGGCATATCTGGATTCGAGGCCTTTGTCATGGTTTCCGCCTCGCCGGCTCTCCTGGTCGGCC
CCATTCGATCCGCTGTCATGAACAATCTTCGGATTGTTCACCTCCTGTCGCTTTCAGGCGTGGCCGCCTACTTAG
TCGTCAGTCCGGTCTGGCGGCTCGTCACCGTCGGCTTTGCAGTTGCTATCTCGACCATGGGCTGGGTGGCCACCC
TTTACTCCGAGTCCGCGCACGAGACCCGGTTCGAGTCCAAGCTGCTGGGTCTGATGGTCGGCTTGATCCTGTCAT
CGACGGCCAAATTTGCCTGGCAGACAAACAACCCCATATGGCCCGTCCTGCACGCTGCCAACGGTGGCTGGAATG
CCACTGGCCTCGCCCTCGGAGTCTTGGCCGCACTGCGCTTCACCCGGAGAGCGCCCCTCACTGGCGGCTCCGGGT
CAGGAGGGAATCAAGGAGGGTCGGCAGTCCTCGCCGCCTTCGGCATCGGCGGTCTTTTCTTCGGGCTTCACTCGC
TGCTCTCCGACACCAGCACCATGATTCTGTGGGTGTGGGAAGGATACCCCATCCGCGGTCCCTACTTCTCGACTC
ACGGCTGGTGTACGATAGCCGCCATGTCGGTAGGCCTATTCCTCGGCATCTCCAGGCCCTCTCTCGCTGGCGGCT
GGCCGCCGTACGCCGTCGGCACACTTGGCGCCATTCTCCTGACCTTCACCAGCCATTGGTCGGGATACTTTGGCG
GCCTGGCCCTCGGAACGTATCTCACGGCCGTCTCCGTCCCCCTGATTTCCACGGCCTCCAAGAAGAGCCCCGCGG
TGACGTTCGGCCTGGGATTTTTCATCTACGTCTTCATGGTTTTGTTCCACGTCTGGGTCGTCGCCTATGCATTTG
TACCCGGCGGCCCTCTTGTACGTGAGCACACAGACTGGATCATGGCGACCATGGTGGGACTTCTTGGCGCCGGTG
TCTTCAACTACAACACGTCGCAGCCGCGACGACAACAGCCTCGTCGACCTTCGGCATCGCAGCACAAGAAATACT
TTGGCCTGTCCACACTCATCGTCAACATTCTCTTCTTGTGTGCGGCGTTCAAGCGCTTCCCGACAAACGACTACA
AGCCGTATCACGCCGAGGACCGCGTCATGACGGCGGGCATCTGGACCATTCACTTCTCCCTCGACAACGACATGT
GGTCCTCCGAGTACCGCATGCGCGACCTCATCAAGGAGCTGGAGCTGGACGTCGTTGGCCTCCTCGAGTCGGATC
TGCAGCGCATCATTATGGGCAACCGAGACACGACGCAGTTCCTAGCCGAAGATCTTGGCATGTACGTCGACTATG
GGCCTGGTCCTAACAAGCACACCTGGGGCTCCGCCCTCCTGTCCAAGTTCCCCATCGTGGAGTCGAAGCACCACC
TCCTTCCCAGCCCCGTTGGCGAGCTGGCTCCGGCCATCCATGCCACTCTAGACGTGTACGGCCAACTCGTCGACG
TCTTCGTCTTTCACTCGGGACAGGAAGAGGACCCGGAGGATCGGCGGCTGCAGACCGAATACCTATCGGAGCTCA
TGGGGGCGACTTCCCGCCCGGCCGTGCTCCTCAGCTACCTGGTGACCAGGCCGCTCGAAGGCAACTACAACACGT
ACGTCGGAGCCAAGTCGGGCATGCACGACATCGACCCGACGGACTGGGACCGCTGGTGCGAGTACATCCTGTACA
AGGGTCTCAAACGCGTGGGCTACGCGCGCGTCAGCCGCAGCACCATCACCGACACGGAGCTACAGGTCGGCAAGT
TTGTCATTCCTCACTCGCCGTCCGAATCAGCCCAGCTGGACGCGCAGTCAGCAGAGCAGCGCAATCACCAGGTGC
AGGAGTCGGAGGTGCCCGAGGGATGGAGGTTCCCGGCCATGTTCCGAGGCAACGGCGTGAGGGGCCATCGCTACC
ATGTATTCAATGAGCCGCGCTACTTCAACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail