Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6786
Gene name
LocationContig_362:10622..13761
Strand+
Gene length (bp)3139
Transcript length (bp)2910
Coding sequence length (bp)2910
Protein length (aa) 970

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04388 Hamartin Hamartin protein 5.5E-24 186 844

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09778|TSC1_SCHPO Tuberous sclerosis 1 protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsc1 PE=1 SV=1 29 866 3.0E-46
sp|Q9Z136|TSC1_RAT Hamartin OS=Rattus norvegicus GN=Tsc1 PE=1 SV=1 114 421 3.0E-10
sp|Q92574|TSC1_HUMAN Hamartin OS=Homo sapiens GN=TSC1 PE=1 SV=2 115 408 1.0E-09
sp|Q9EP53|TSC1_MOUSE Hamartin OS=Mus musculus GN=Tsc1 PE=1 SV=1 114 408 2.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6786
MASPASLKDLSKAIQAFASHPTLPLPDNLLETIEGYLQRHEKHDDASSDRLQEELLSIFDKHVKGNSTASGPWIG
LLRRLLPALPTPERILPWFDSCKGLLDRTGLDRLVVDEAVGALVDLVSLTEEHYASCGGDSATNPVIDRLLSIWM
TRFYPSLAEGNKAHEYSERIVRQALKRFGKKRPKEFFTSMDGCFVKRQYRHATLRFLCDFIQDQPPHLHQILHTS
IFCNLLSCLQQDTSTTVISSALTVLIMLLPHMPSSLVPHLPTLFNIYARLLFWDREKCRAVGALSDDVDQQSRGW
EACTYDFEIDNFSVPQLSNYYTILYGLYPINFMDYIRKPHRYLRHANMSSPDEIEVQPTEIRHRSERFRRCHLLH
PNFYTLTIDSEKTDFGRWIKSEAAEVLVDCMELCRVVNLYDSNDGDVPPPMPGSAAGAVDEELDGKDVADPALLA
GTVGKLEGWRNSQLTNTDSESSNQAAPLMKHRVSQSSQPPSRQNAEEGPATTRGIDSPTIPAQLTHSLSQSQLQD
LIHSNKVIKSGLHQSLANDSVPSLSLSHQESAAGGPAGPAENAMLPPLPTGSPLAAAALGNSVAHLQRRVLVLEN
DLSFERFVKQQHMAHIGELRRRQVVEAATEAETQNLIMMNRNLKSRFEEAKKGEKQVRKESEKGRALAKKWESDL
ANKLKHLRDESKRASAELGALRRELEESRAECEKLRKLVCAAEVKELSWQQSMQSIETQGAVVDRLKSQVEELTK
SEHDSQARELERQVAISSAERAGAQVEKMRLELAAQEDDAERARGLLEAQVAELQAQLAETQEEKVRPGSNSNLA
IESAFAASRAKQAELQTQYNLLTRKYTALQSSLLDMQSGAEAEAAMTARARLSLSEAAEAAAGSHPSTPTSSTGP
EGRASTTEGPGTGPAPMSPGDARHSGSDRMRKEARDKANGGEAAAPAAGGSKPKKEKKSSGLRGIRGFV*
Coding >Hirsu2|6786
ATGGCCTCACCAGCGTCCCTCAAGGATCTATCCAAGGCGATCCAAGCCTTCGCTTCGCATCCGACGCTCCCGCTC
CCCGACAACCTGCTCGAAACCATCGAGGGCTATCTCCAACGACACGAGAAGCATGACGACGCCTCGTCAGACCGA
CTCCAGGAGGAGCTGCTGAGCATCTTCGACAAGCACGTAAAAGGGAACTCCACCGCATCGGGACCCTGGATAGGC
CTTCTGCGGCGCCTTCTTCCCGCCCTGCCGACCCCTGAGCGGATTTTGCCGTGGTTCGATTCTTGCAAGGGCCTC
CTCGACCGGACCGGCCTCGACAGACTTGTCGTCGACGAGGCCGTTGGCGCCCTGGTCGACCTCGTGTCGCTCACC
GAGGAACATTATGCCAGCTGCGGGGGGGATTCGGCTACAAACCCCGTTATCGATCGACTCTTGTCCATATGGATG
ACGCGCTTCTATCCCTCCTTGGCCGAAGGGAACAAGGCTCATGAATACAGCGAGAGAATCGTCCGGCAGGCTTTG
AAGCGCTTCGGAAAGAAGAGACCAAAGGAGTTTTTCACGTCCATGGACGGCTGCTTTGTCAAGAGGCAGTACCGC
CATGCCACTCTGAGGTTCTTGTGCGACTTCATCCAGGACCAGCCTCCACATCTACACCAGATCCTGCATACCTCT
ATCTTCTGCAACCTGCTAAGCTGCCTTCAGCAGGACACGTCTACGACTGTCATTTCCTCGGCCCTGACTGTTCTC
ATCATGCTGCTGCCCCATATGCCAAGTTCTCTCGTGCCGCATCTACCGACCCTGTTCAACATCTACGCTCGCCTG
CTCTTCTGGGACCGAGAAAAGTGTAGGGCCGTCGGCGCCTTGTCCGACGACGTCGATCAACAGTCTCGGGGTTGG
GAGGCTTGCACCTACGACTTCGAAATCGACAACTTTTCGGTACCGCAACTTTCCAACTACTACACCATTCTGTAT
GGCCTGTATCCTATCAACTTTATGGACTATATCCGCAAGCCCCACCGCTATCTACGTCACGCCAACATGTCGAGT
CCGGACGAGATTGAAGTCCAACCTACGGAGATACGACATCGGTCCGAACGCTTCAGGCGTTGCCATCTGCTGCAT
CCAAACTTCTACACGCTCACCATCGACTCCGAGAAGACAGACTTCGGCCGCTGGATCAAGAGCGAGGCTGCCGAG
GTCTTGGTTGACTGCATGGAGCTTTGTCGGGTTGTCAACTTGTACGATTCGAACGACGGCGACGTTCCGCCGCCC
ATGCCGGGCTCCGCCGCCGGCGCCGTCGACGAGGAGCTCGATGGCAAAGATGTGGCCGACCCGGCCCTCCTGGCA
GGCACGGTAGGCAAGCTGGAGGGCTGGCGGAACTCGCAATTGACGAACACGGATTCGGAGTCGAGCAACCAGGCG
GCTCCGCTGATGAAGCACCGCGTCTCTCAGTCGAGCCAGCCACCGAGCCGGCAAAACGCGGAGGAGGGTCCCGCG
ACGACTCGCGGGATCGACAGTCCGACGATCCCGGCACAGCTCACACACTCTCTTTCGCAGAGCCAACTGCAAGAC
CTGATTCATTCCAACAAGGTGATCAAGTCCGGGCTGCACCAGTCGCTCGCGAATGACAGTGTCCCCTCGCTCTCG
CTCAGCCACCAAGAGTCGGCGGCCGGCGGGCCGGCGGGACCGGCGGAAAACGCGATGTTGCCGCCGCTGCCGACG
GGCTCACCCCTGGCCGCGGCGGCGCTGGGCAATTCGGTGGCTCACCTGCAGCGCCGAGTGCTGGTTCTCGAAAAC
GACTTGAGCTTCGAGAGGTTTGTCAAGCAGCAGCACATGGCCCACATAGGCGAGCTGCGGCGACGGCAGGTGGTG
GAGGCGGCGACCGAGGCCGAGACTCAGAATCTGATTATGATGAACCGCAACCTCAAGAGCCGGTTCGAAGAAGCA
AAGAAGGGCGAGAAGCAGGTGCGAAAGGAGTCGGAAAAGGGGCGAGCGCTGGCCAAGAAGTGGGAGTCGGACCTG
GCGAACAAGCTCAAACACCTGCGGGACGAGTCGAAGAGGGCCTCGGCCGAGCTTGGTGCGCTCCGGCGGGAGCTG
GAAGAGTCGAGGGCGGAGTGCGAAAAGCTGCGCAAGTTGGTGTGCGCGGCCGAGGTCAAGGAGCTCAGCTGGCAG
CAGAGCATGCAGTCGATCGAGACACAGGGCGCGGTGGTGGATCGGCTGAAGTCGCAGGTCGAGGAGCTGACCAAG
TCGGAGCACGACAGCCAGGCGCGGGAGCTGGAGCGGCAGGTGGCGATCAGCTCGGCCGAGAGAGCCGGGGCGCAG
GTGGAGAAGATGAGGCTGGAGCTGGCGGCACAGGAAGACGACGCGGAGCGAGCTCGAGGCCTGCTCGAGGCCCAG
GTGGCGGAGCTCCAGGCACAGCTGGCGGAGACGCAGGAGGAAAAGGTGCGGCCGGGGTCCAACTCGAACCTGGCG
ATAGAGAGCGCGTTTGCGGCGAGCCGAGCGAAGCAGGCGGAGCTACAGACGCAGTACAACCTACTGACGCGCAAG
TACACGGCCCTGCAGTCGTCGCTGCTCGACATGCAGTCGGGGGCGGAGGCGGAGGCGGCGATGACGGCGCGGGCG
CGGCTATCCCTGTCGGAAGCGGCGGAAGCGGCGGCGGGGTCTCATCCGAGCACGCCCACGTCGTCGACGGGGCCG
GAGGGGCGGGCGAGCACGACGGAAGGGCCCGGGACGGGGCCCGCGCCCATGAGCCCCGGCGACGCGCGGCACTCT
GGCAGCGACCGGATGCGCAAGGAAGCTCGGGACAAGGCCAACGGGGGGGAGGCGGCGGCGCCGGCGGCGGGCGGC
AGCAAGCCCAAGAAGGAGAAGAAGTCGTCGGGGCTGCGAGGCATCCGGGGATTCGTGTGA
Transcript >Hirsu2|6786
ATGGCCTCACCAGCGTCCCTCAAGGATCTATCCAAGGCGATCCAAGCCTTCGCTTCGCATCCGACGCTCCCGCTC
CCCGACAACCTGCTCGAAACCATCGAGGGCTATCTCCAACGACACGAGAAGCATGACGACGCCTCGTCAGACCGA
CTCCAGGAGGAGCTGCTGAGCATCTTCGACAAGCACGTAAAAGGGAACTCCACCGCATCGGGACCCTGGATAGGC
CTTCTGCGGCGCCTTCTTCCCGCCCTGCCGACCCCTGAGCGGATTTTGCCGTGGTTCGATTCTTGCAAGGGCCTC
CTCGACCGGACCGGCCTCGACAGACTTGTCGTCGACGAGGCCGTTGGCGCCCTGGTCGACCTCGTGTCGCTCACC
GAGGAACATTATGCCAGCTGCGGGGGGGATTCGGCTACAAACCCCGTTATCGATCGACTCTTGTCCATATGGATG
ACGCGCTTCTATCCCTCCTTGGCCGAAGGGAACAAGGCTCATGAATACAGCGAGAGAATCGTCCGGCAGGCTTTG
AAGCGCTTCGGAAAGAAGAGACCAAAGGAGTTTTTCACGTCCATGGACGGCTGCTTTGTCAAGAGGCAGTACCGC
CATGCCACTCTGAGGTTCTTGTGCGACTTCATCCAGGACCAGCCTCCACATCTACACCAGATCCTGCATACCTCT
ATCTTCTGCAACCTGCTAAGCTGCCTTCAGCAGGACACGTCTACGACTGTCATTTCCTCGGCCCTGACTGTTCTC
ATCATGCTGCTGCCCCATATGCCAAGTTCTCTCGTGCCGCATCTACCGACCCTGTTCAACATCTACGCTCGCCTG
CTCTTCTGGGACCGAGAAAAGTGTAGGGCCGTCGGCGCCTTGTCCGACGACGTCGATCAACAGTCTCGGGGTTGG
GAGGCTTGCACCTACGACTTCGAAATCGACAACTTTTCGGTACCGCAACTTTCCAACTACTACACCATTCTGTAT
GGCCTGTATCCTATCAACTTTATGGACTATATCCGCAAGCCCCACCGCTATCTACGTCACGCCAACATGTCGAGT
CCGGACGAGATTGAAGTCCAACCTACGGAGATACGACATCGGTCCGAACGCTTCAGGCGTTGCCATCTGCTGCAT
CCAAACTTCTACACGCTCACCATCGACTCCGAGAAGACAGACTTCGGCCGCTGGATCAAGAGCGAGGCTGCCGAG
GTCTTGGTTGACTGCATGGAGCTTTGTCGGGTTGTCAACTTGTACGATTCGAACGACGGCGACGTTCCGCCGCCC
ATGCCGGGCTCCGCCGCCGGCGCCGTCGACGAGGAGCTCGATGGCAAAGATGTGGCCGACCCGGCCCTCCTGGCA
GGCACGGTAGGCAAGCTGGAGGGCTGGCGGAACTCGCAATTGACGAACACGGATTCGGAGTCGAGCAACCAGGCG
GCTCCGCTGATGAAGCACCGCGTCTCTCAGTCGAGCCAGCCACCGAGCCGGCAAAACGCGGAGGAGGGTCCCGCG
ACGACTCGCGGGATCGACAGTCCGACGATCCCGGCACAGCTCACACACTCTCTTTCGCAGAGCCAACTGCAAGAC
CTGATTCATTCCAACAAGGTGATCAAGTCCGGGCTGCACCAGTCGCTCGCGAATGACAGTGTCCCCTCGCTCTCG
CTCAGCCACCAAGAGTCGGCGGCCGGCGGGCCGGCGGGACCGGCGGAAAACGCGATGTTGCCGCCGCTGCCGACG
GGCTCACCCCTGGCCGCGGCGGCGCTGGGCAATTCGGTGGCTCACCTGCAGCGCCGAGTGCTGGTTCTCGAAAAC
GACTTGAGCTTCGAGAGGTTTGTCAAGCAGCAGCACATGGCCCACATAGGCGAGCTGCGGCGACGGCAGGTGGTG
GAGGCGGCGACCGAGGCCGAGACTCAGAATCTGATTATGATGAACCGCAACCTCAAGAGCCGGTTCGAAGAAGCA
AAGAAGGGCGAGAAGCAGGTGCGAAAGGAGTCGGAAAAGGGGCGAGCGCTGGCCAAGAAGTGGGAGTCGGACCTG
GCGAACAAGCTCAAACACCTGCGGGACGAGTCGAAGAGGGCCTCGGCCGAGCTTGGTGCGCTCCGGCGGGAGCTG
GAAGAGTCGAGGGCGGAGTGCGAAAAGCTGCGCAAGTTGGTGTGCGCGGCCGAGGTCAAGGAGCTCAGCTGGCAG
CAGAGCATGCAGTCGATCGAGACACAGGGCGCGGTGGTGGATCGGCTGAAGTCGCAGGTCGAGGAGCTGACCAAG
TCGGAGCACGACAGCCAGGCGCGGGAGCTGGAGCGGCAGGTGGCGATCAGCTCGGCCGAGAGAGCCGGGGCGCAG
GTGGAGAAGATGAGGCTGGAGCTGGCGGCACAGGAAGACGACGCGGAGCGAGCTCGAGGCCTGCTCGAGGCCCAG
GTGGCGGAGCTCCAGGCACAGCTGGCGGAGACGCAGGAGGAAAAGGTGCGGCCGGGGTCCAACTCGAACCTGGCG
ATAGAGAGCGCGTTTGCGGCGAGCCGAGCGAAGCAGGCGGAGCTACAGACGCAGTACAACCTACTGACGCGCAAG
TACACGGCCCTGCAGTCGTCGCTGCTCGACATGCAGTCGGGGGCGGAGGCGGAGGCGGCGATGACGGCGCGGGCG
CGGCTATCCCTGTCGGAAGCGGCGGAAGCGGCGGCGGGGTCTCATCCGAGCACGCCCACGTCGTCGACGGGGCCG
GAGGGGCGGGCGAGCACGACGGAAGGGCCCGGGACGGGGCCCGCGCCCATGAGCCCCGGCGACGCGCGGCACTCT
GGCAGCGACCGGATGCGCAAGGAAGCTCGGGACAAGGCCAACGGGGGGGAGGCGGCGGCGCCGGCGGCGGGCGGC
AGCAAGCCCAAGAAGGAGAAGAAGTCGTCGGGGCTGCGAGGCATCCGGGGATTCGTGTGA
Gene >Hirsu2|6786
ATGGCCTCACCAGCGTACGTTTGCTAGGACTCCCAGCTCTCCCTCCTTCCTGAACTGCCCTGCTCTGGCAGCCGC
TTCCCTTGCTGTTGCAGCGCGCTGACCCTTGCTCCCCGGCAGGTCCCTCAAGGATCTATCCAAGGCGATCCAAGC
CTTCGCTTCGCATCCGACGCTCCCGCTCCCCGACAACCTGCTCGAAACCATCGAGGGCTATCTCCAACGACACGA
GAAGCATGACGACGCCTCGTCAGACCGACTCCAGGAGGAGCTGCTGAGCATCTTCGACAAGCACGTAAAAGGGAA
CTCCACCGCATCGGGACCCTGGATAGGCCTTCTGCGGCGCCTTCTTCCCGCCCTGCCGACCCCTGAGCGGATTTT
GCCGTGGTTCGATTCTTGCAAGGGCCTCCTCGACCGGACCGGCCTCGACAGACTTGTCGTCGACGAGGCCGTTGG
CGCCCTGGTCGACCTCGTGTCGCTCACCGAGGAACATTATGCCAGCTGCGGGGGGGATTCGGCTACAAACCCCGT
TATCGATCGACTCTTGTCCATATGGATGACGCGCTTCTATCCCTCCTTGGCCGAAGGGAACAAGGCTCATGAATA
CAGCGAGAGAATCGTCCGGCAGGCTTTGAAGCGCTTCGGAAAGAAGAGACCAAAGGTAACTGGCCACTTTGCGCA
GATGAATCTAATGCTGATTCGCCTCCTCAGGAGTTTTTCACGTCCATGGACGGCTGCTTTGTCAAGAGGCAGTAC
CGCCATGCCACTCTGAGGTTCTTGTGCGACTTCATCCAGGACCAGCCTCCACATCTACACCAGATCCTGCATACC
TCTATCTTCTGCAACCTGCTAAGCTGCCTTCAGCAGGACACGTCTACGACTGTCATTTCCTCGGCCCTGACTGTT
CTCATCATGCTGCTGCCCCATATGCCAAGTTCTCTCGTGCCGCATCTACCGACCCTGTTCAACATCTACGCTCGC
CTGCTCTTCTGGGACCGAGAAAAGTGTAGGGCCGTCGGCGCCTTGTCCGACGACGTCGATCAACAGTCTCGGGGT
TGGGAGGCTTGCACCTACGACTTCGAAATCGACAACTTTTCGGTACCGCAACTTTCCAACTACTACACCATTCTG
TATGGCCTGTATCCTATCAACTTTATGGACTATATCCGCAAGCCCCACCGCTATCTACGTCACGCCAACATGTCG
AGTCCGGACGAGATTGAAGTCCAACCTACGGAGATACGACATCGGTCCGAACGCTTCAGGCGTTGCCATCTGCTG
CATCCAAACTTCTACACGCTCACCATCGACTCCGAGAAGACAGACTTCGGCCGCTGGATCAAGAGCGAGGCTGCC
GAGGTCTTGGTTGACTGCATGGAGCTTTGTCGGGTTGTCAACTTGTACGATTCGAACGACGGCGACGTTCCGCCG
CCCATGCCGGGCTCCGCCGCCGGCGCCGTCGACGAGGAGCTCGATGGCAAAGATGTGGCCGACCCGGCCCTCCTG
GCAGGCACGGTAGGCAAGCTGGAGGGCTGGCGGAACTCGCAATTGACGAACACGGATTCGGAGTCGAGCAACCAG
GCGGCTCCGCTGATGAAGCACCGCGTCTCTCAGTCGAGCCAGCCACCGAGCCGGCAAAACGCGGAGGAGGGTCCC
GCGACGACTCGCGGGATCGACAGTCCGACGATCCCGGCACAGCTCACACACTCTCTTTCGCAGAGCCAACTGCAA
GACCTGATTCATTCCAACAAGGTGATCAAGTCCGGGCTGCACCAGTCGCTCGCGAATGACAGTGTCCCCTCGCTC
TCGCTCAGCCACCAAGAGTCGGCGGCCGGCGGGCCGGCGGGACCGGCGGAAAACGCGATGTTGCCGCCGCTGCCG
ACGGGCTCACCCCTGGCCGCGGCGGCGCTGGGCAATTCGGTGGCTCACCTGCAGCGCCGAGTGCTGGTTCTCGAA
AACGACTTGAGCTTCGAGAGGTTTGTCAAGCAGCAGCACATGGCCCACATAGGCGAGCTGCGGCGACGGCAGGTG
GTGGAGGCGGCGACCGAGGCCGAGACTCAGAATCTGATTATGATGAACCGCAACCTCAAGAGCCGGTTCGAAGAA
GCAAAGAAGGGCGAGAAGCAGGTGCGAAAGGAGTCGGAAAAGGGGCGAGCGCTGGCCAAGAAGTGGGAGTCGGAC
CTGGCGAACAAGCTCAAACACCTGCGGGACGAGTCGAAGAGGGCCTCGGCCGAGCTTGGTGCGCTCCGGCGGGAG
CTGGAAGAGTCGAGGGCGGAGTGCGAAAAGCTGCGCAAGTTGGTGTGCGCGGCCGAGGTCAAGGAGCTCAGCTGG
CAGCAGAGCATGCAGTCGATCGAGACACAGGGCGCGGTGGTGGATCGGCTGAAGTCGCAGGTCGAGGAGCTGACC
AAGTCGGAGCACGACAGCCAGGCGCGGGAGCTGGAGCGGCAGGTGGCGATCAGCTCGGCCGAGAGAGCCGGGGCG
CAGGTGGAGAAGATGAGGCTGGAGCTGGCGGCACAGGAAGACGACGCGGAGCGAGCTCGAGGCCTGCTCGAGGCC
CAGGTGGCGGAGCTCCAGGCACAGCTGGCGGAGACGCAGGAGGAAAAGGTGCGGCCGGGGTCCAACTCGAACCTG
GCGATAGAGAGCGCGTTTGCGGCGAGCCGAGCGAAGCAGGCGGAGCTACAGACGCAGTACAACCTACTGACGCGC
AAGTACACGGCCCTGCAGTCGTCGCTGCTCGACATGCAGTCGGGGGCGGAGGCGGAGGCGGCGATGACGGCGCGG
GCGCGGCTATCCCTGTCGGAAGCGGCGGAAGCGGCGGCGGGGTCTCATCCGAGCACGCCCACGTCGTCGACGGGG
CCGGAGGGGCGGGCGAGCACGACGGAAGGGCCCGGGACGGGGCCCGCGCCCATGAGCCCCGGCGACGCGCGGCAC
TCTGGCAGTAAGTCAAAGCGGGAGGCATAGCCGTGCCAGGGGAAGGGGGAGGGGGCTAAGACTGATGGCTAACGG
GTTGGCAGGCGACCGGATGCGCAAGGAAGCTCGGGACAAGGCCAACGGGGGGGAGGCGGCGGCGCCGGCGGCGGG
CGGCAGCAAGCCCAAGAAGGAGAAGAAGTCGTCGGGGCTGCGAGGCATCCGGGGATTCGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail