Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6782
Gene name
LocationContig_361:17169..21075
Strand+
Gene length (bp)3906
Transcript length (bp)3822
Coding sequence length (bp)3822
Protein length (aa) 1274

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16414 NPC1_N Niemann-Pick C1 N terminus 6.9E-84 33 265
PF02460 Patched Patched family 2.2E-43 520 869
PF02460 Patched Patched family 8.5E-27 997 1234
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 3.1E-50 625 777

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12200|NPC1_YEAST Niemann-Pick type C-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCR1 PE=1 SV=1 35 1247 0.0E+00
sp|O15118|NPC1_HUMAN Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2 35 1260 0.0E+00
sp|O35604|NPC1_MOUSE Niemann-Pick C1 protein OS=Mus musculus GN=Npc1 PE=1 SV=2 35 1260 0.0E+00
sp|P56941|NPC1_PIG Niemann-Pick C1 protein OS=Sus scrofa GN=NPC1 PE=2 SV=1 35 1236 0.0E+00
sp|Q6T3U3|NPCL1_RAT Niemann-Pick C1-like protein 1 OS=Rattus norvegicus GN=Npc1l1 PE=1 SV=1 27 1236 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12200|NPC1_YEAST Niemann-Pick type C-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCR1 PE=1 SV=1 35 1247 0.0E+00
sp|O15118|NPC1_HUMAN Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2 35 1260 0.0E+00
sp|O35604|NPC1_MOUSE Niemann-Pick C1 protein OS=Mus musculus GN=Npc1 PE=1 SV=2 35 1260 0.0E+00
sp|P56941|NPC1_PIG Niemann-Pick C1 protein OS=Sus scrofa GN=NPC1 PE=2 SV=1 35 1236 0.0E+00
sp|Q6T3U3|NPCL1_RAT Niemann-Pick C1-like protein 1 OS=Rattus norvegicus GN=Npc1l1 PE=1 SV=1 27 1236 0.0E+00
sp|Q6T3U4|NPCL1_MOUSE Niemann-Pick C1-like protein 1 OS=Mus musculus GN=Npc1l1 PE=2 SV=1 21 1236 1.0E-163
sp|Q9UHC9|NPCL1_HUMAN Niemann-Pick C1-like protein 1 OS=Homo sapiens GN=NPC1L1 PE=1 SV=2 23 1236 3.0E-158
sp|P34389|NPC2_CAEEL Niemann-Pick C1 protein homolog 2 OS=Caenorhabditis elegans GN=ncr-2 PE=3 SV=2 80 1255 8.0E-97
sp|Q19127|NPC1_CAEEL Niemann-Pick C1 protein homolog 1 OS=Caenorhabditis elegans GN=ncr-1 PE=1 SV=2 30 1255 2.0E-96
sp|Q0EEE2|PTHD3_MOUSE Patched domain-containing protein 3 OS=Mus musculus GN=Ptchd3 PE=1 SV=1 514 1234 6.0E-39
sp|Q13635|PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens GN=PTCH1 PE=1 SV=2 571 774 6.0E-19
sp|Q90693|PTC1_CHICK Protein patched homolog 1 OS=Gallus gallus GN=PTCH1 PE=1 SV=1 571 774 8.0E-19
sp|Q61115|PTC1_MOUSE Protein patched homolog 1 OS=Mus musculus GN=Ptch1 PE=1 SV=1 571 774 3.0E-18
sp|Q9Y6C5|PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens GN=PTCH2 PE=2 SV=2 551 773 8.0E-17
sp|Q13635|PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens GN=PTCH1 PE=1 SV=2 1025 1243 3.0E-16
sp|O35595|PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus GN=Ptch2 PE=2 SV=2 551 773 4.0E-16
sp|B9EKX1|PTHD4_MOUSE Patched domain-containing protein 4 OS=Mus musculus GN=Ptchd4 PE=2 SV=2 328 1234 5.0E-16
sp|Q90693|PTC1_CHICK Protein patched homolog 1 OS=Gallus gallus GN=PTCH1 PE=1 SV=1 1025 1243 9.0E-16
sp|Q61115|PTC1_MOUSE Protein patched homolog 1 OS=Mus musculus GN=Ptch1 PE=1 SV=1 1025 1243 1.0E-15
sp|Q3KNS1|PTHD3_HUMAN Patched domain-containing protein 3 OS=Homo sapiens GN=PTCHD3 PE=1 SV=3 513 897 1.0E-15
sp|Q96NR3|PTHD1_HUMAN Patched domain-containing protein 1 OS=Homo sapiens GN=PTCHD1 PE=2 SV=2 343 1151 3.0E-15
sp|Q09614|PTC1_CAEEL Protein patched homolog 1 OS=Caenorhabditis elegans GN=ptc-1 PE=1 SV=2 1023 1243 3.0E-14
sp|Q98864|PTC1_DANRE Protein patched homolog 1 OS=Danio rerio GN=ptch1 PE=2 SV=1 1025 1220 3.0E-14
sp|O35595|PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus GN=Ptch2 PE=2 SV=2 1025 1210 2.0E-13
sp|Q09614|PTC1_CAEEL Protein patched homolog 1 OS=Caenorhabditis elegans GN=ptc-1 PE=1 SV=2 562 897 3.0E-13
sp|Q98864|PTC1_DANRE Protein patched homolog 1 OS=Danio rerio GN=ptch1 PE=2 SV=1 589 773 5.0E-13
sp|Q6ZW05|PTHD4_HUMAN Patched domain-containing protein 4 OS=Homo sapiens GN=PTCHD4 PE=2 SV=3 521 1234 5.0E-13
sp|Q9Y6C5|PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens GN=PTCH2 PE=2 SV=2 1025 1210 6.0E-13
sp|Q6GQT6|SCAP_MOUSE Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus GN=Scap PE=1 SV=1 551 767 1.0E-12
sp|Q5MNU5|SCAP_PIG Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 551 767 4.0E-12
sp|A2RRU4|SCAP_RAT Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus GN=Scap PE=2 SV=1 551 767 4.0E-12
sp|Q12770|SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens GN=SCAP PE=1 SV=4 551 767 4.0E-12
sp|P97260|SCAP_CRIGR Sterol regulatory element-binding protein cleavage-activating protein OS=Cricetulus griseus GN=SCAP PE=1 SV=1 551 767 6.0E-12
sp|A6QM06|SCAP_BOVIN Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 551 767 6.0E-12
sp|Q14B62|PTHD1_MOUSE Patched domain-containing protein 1 OS=Mus musculus GN=Ptchd1 PE=2 SV=2 343 879 2.0E-11
sp|A0JPH4|SCAP_XENLA Sterol regulatory element-binding protein cleavage-activating protein OS=Xenopus laevis GN=scap PE=2 SV=1 551 767 3.0E-11
sp|P18502|PTC_DROME Protein patched OS=Drosophila melanogaster GN=ptc PE=2 SV=2 531 860 4.0E-11
sp|Q03602|PTR9_CAEEL Patched-related protein 9 OS=Caenorhabditis elegans GN=ptr-9 PE=3 SV=2 616 761 5.0E-08
sp|P18502|PTC_DROME Protein patched OS=Drosophila melanogaster GN=ptc PE=2 SV=2 1047 1246 3.0E-06
sp|Q03602|PTR9_CAEEL Patched-related protein 9 OS=Caenorhabditis elegans GN=ptr-9 PE=3 SV=2 1045 1243 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 269 291 22
2 351 373 22
3 593 610 17
4 631 653 22
5 658 680 22
6 711 733 22
7 738 760 22
8 826 848 22
9 1068 1090 22
10 1097 1119 22
11 1129 1151 22
12 1172 1194 22
13 1209 1231 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6782
MRHRVVPLLAAASLPLPGIVAAADSLTPKHEPGRCAFRGQCGKQSFFGKDLPCVDNGPAQDPEPELRKELVDLCG
AQWSESPVCCTLEQVKNLKSQLGTPNTMIGSCPACKYNFFNLFCTFTCSPDQSLFVNVTKAADKNGKKLVTELDQ
LISDEYGTGFYDSCKEVKFGGANSRAMDLIGGGAKDYHQLLKFLGDERPLVGSPFQINFPDTYSQPGMGPLDMHP
KQCNDTDPDYRCVCVDCPEVCPTLPAVEKHGSCRVGALPCLSFASIFTYSVLLFALAAFVFGHVAWRRYARNRVE
RTRLLHEASHSDDEDEGGPVLTEAMRDRPTKRYWLNDKCDKAFNTLGHTAARFPGLTIGASLLVVAILSAGWFRF
DLEREPARLWVSPTSAAAQEKEYFDSNFGPFYRAEKVFLVNDSNPDGPGPVLSYETLKWWIGVEQSVDKIASPTF
GDSLQDLCFKPANDACVVQSVTAYWWARGGFSSTSWRDQLRSCARSPVNCRPKFGQPIEPNMILGGYGDDVTDAR
AITVTWVVNNAQEGTGALARAIDWENALRDRLLKVQDEAKDRGLRLSFTTEISLEQELNKSTNTDAKIVVISYVV
MFIYACMALGTPLKHVFRNPALLLVESKVTLGLVGIVIVLMSIAASIGFFSWVGLKATLIIVEVIPFIVLAVGVD
NIFLIVHELERVNVSCPDQMVEERVARALGRMGPSILFSALTETVAFALGAAVGMPAVRNFAAYAAGAVFVNAIL
QMTMFVSFLALNQMRVEDHRCELWPWWQVTKARVHIDGTNGFVSGVRGTHVDEESLLQVFIKNTYAPRLLGKKVK
LGVVTIFFGVFAAALALLPQVQLGLDQRVAIPDGSYLIPYFNDLYDYLETGPPVYFVARGADASHRREQQALCSR
FTSCQPLSVANTLELERQRPDVSYIASPTASWIDDFFLWLNPIYENCCVEGGSACFAGRSPAWNTTLSGMPEEEE
FLHYLHKFLTSPADTSCPLGGQAAYGEAVVINDRNTAVQASHFRTSHTPLRSQADFIKAYSAARRVASDISEKTG
TDVFPYSLFYIFFDQYLSIVGLTAGLLCAAVGIIFVIAALLLGSALTSAVVTATVVMSVVDIMGAMALFDVSLNA
VSLVNLIICVGISVEFCAHIARAFMFPSRTVMEGNNNAFRGRDARAWTALVNVGGSVFSGITVTKLLGVCVLAFT
RSKIFEIYYFRVWLALVVLAALHALVFLPVALSLAGGAGYVDPESEGTAAQDLTDRRWRAIRVHDHSDSEDGF*
Coding >Hirsu2|6782
ATGCGTCATCGCGTCGTCCCTCTCCTCGCGGCCGCGTCTCTGCCTCTACCCGGCATTGTTGCCGCCGCCGATTCT
CTCACGCCCAAACATGAGCCCGGCAGGTGTGCCTTCCGCGGCCAGTGCGGCAAGCAGAGCTTCTTCGGCAAGGAC
CTGCCATGCGTCGACAACGGGCCCGCTCAAGACCCCGAGCCGGAGCTCCGAAAGGAGCTCGTCGACCTGTGCGGC
GCCCAGTGGAGTGAGAGTCCGGTCTGCTGCACTCTCGAACAGGTCAAAAACCTCAAGTCCCAGCTCGGCACGCCC
AACACCATGATTGGCTCCTGTCCGGCCTGCAAGTACAACTTCTTCAACCTATTCTGCACCTTCACCTGCTCTCCC
GATCAGTCCCTCTTCGTCAATGTCACCAAGGCGGCCGACAAGAATGGCAAAAAGCTCGTCACCGAGCTCGATCAG
CTGATATCCGACGAATACGGCACCGGCTTCTACGACAGCTGCAAGGAGGTCAAGTTCGGCGGCGCAAACAGCAGG
GCCATGGACCTTATTGGCGGCGGTGCCAAGGACTACCATCAGCTGCTCAAGTTCCTGGGCGACGAGAGGCCCCTC
GTTGGCTCTCCCTTCCAGATCAACTTTCCTGACACGTACAGCCAGCCTGGAATGGGCCCTCTAGACATGCATCCA
AAGCAGTGCAACGACACAGACCCCGACTACCGCTGCGTCTGTGTTGATTGCCCCGAAGTGTGCCCCACGCTCCCT
GCTGTCGAAAAGCACGGCTCCTGCCGGGTCGGCGCCCTGCCTTGCTTGTCTTTTGCCTCCATCTTCACCTACTCG
GTCCTGCTCTTCGCCCTGGCCGCCTTTGTCTTCGGCCACGTTGCGTGGAGGAGATACGCACGAAACCGTGTCGAG
AGGACGAGGCTCCTGCACGAGGCCTCGCACAGCGATGACGAAGATGAGGGCGGCCCTGTCTTGACCGAGGCGATG
CGTGACCGCCCGACGAAGCGATACTGGCTGAATGACAAGTGCGACAAGGCCTTCAACACGCTCGGCCACACCGCA
GCCCGCTTCCCCGGCCTCACGATTGGCGCCAGTCTGCTGGTCGTCGCCATTCTCAGTGCCGGATGGTTCAGGTTC
GACCTGGAACGGGAGCCGGCGCGGCTTTGGGTCAGCCCGACCTCGGCCGCCGCCCAGGAGAAAGAGTACTTTGAC
TCCAACTTTGGCCCCTTCTACCGCGCGGAGAAGGTCTTCCTCGTCAACGACAGCAACCCGGACGGGCCTGGGCCG
GTCCTGAGCTACGAGACGCTCAAGTGGTGGATCGGGGTGGAGCAGAGCGTTGACAAGATTGCCAGTCCCACGTTT
GGCGACAGCCTGCAGGACCTCTGCTTCAAGCCGGCCAACGACGCCTGTGTCGTGCAGTCTGTCACGGCCTACTGG
TGGGCTCGCGGCGGCTTCAGCTCCACGTCGTGGAGGGATCAGCTGCGCAGCTGCGCCAGGTCTCCCGTCAACTGC
CGGCCGAAATTCGGCCAGCCGATCGAGCCCAACATGATATTGGGCGGATATGGCGACGACGTGACCGATGCTCGC
GCCATCACGGTAACGTGGGTGGTCAACAATGCGCAGGAGGGCACCGGCGCCCTGGCTAGGGCCATCGATTGGGAG
AACGCCCTCCGTGATCGGTTGCTCAAGGTACAGGACGAGGCCAAGGATCGAGGGCTCCGACTCTCCTTCACCACG
GAGATCAGCCTGGAGCAAGAACTCAACAAGTCGACAAACACCGACGCCAAGATCGTCGTCATCAGCTACGTCGTC
ATGTTCATCTACGCCTGCATGGCGCTGGGCACGCCTCTGAAGCATGTCTTCCGGAACCCCGCCCTGCTGCTCGTC
GAGTCCAAGGTGACACTGGGCCTGGTCGGCATCGTCATCGTCCTCATGTCCATTGCCGCCTCCATCGGCTTCTTC
TCCTGGGTCGGCCTCAAGGCCACCCTCATCATCGTCGAGGTGATACCCTTCATCGTCCTGGCCGTCGGCGTCGAC
AACATCTTCCTCATCGTGCATGAGCTGGAGAGGGTCAACGTGAGCTGCCCCGACCAGATGGTGGAGGAGCGCGTG
GCGAGAGCCCTCGGCCGCATGGGCCCGTCCATCCTCTTCTCCGCCCTGACGGAGACGGTCGCGTTCGCACTGGGA
GCAGCGGTTGGCATGCCTGCCGTCAGGAACTTTGCCGCCTACGCCGCCGGAGCCGTGTTTGTCAACGCCATTCTG
CAGATGACCATGTTCGTCTCCTTCCTCGCCCTGAACCAGATGCGGGTCGAAGACCATCGGTGCGAGCTCTGGCCG
TGGTGGCAAGTAACCAAGGCCCGCGTGCACATCGACGGCACCAACGGCTTCGTCTCCGGCGTGAGAGGCACGCAC
GTCGACGAAGAGAGCCTCCTGCAAGTCTTCATCAAGAACACGTACGCCCCGCGTCTGCTCGGCAAGAAGGTCAAG
CTCGGCGTCGTCACCATCTTCTTCGGCGTCTTCGCCGCCGCCTTAGCGCTCCTGCCCCAGGTGCAGCTCGGGCTG
GACCAGCGCGTGGCGATCCCGGACGGCTCGTATCTCATTCCCTACTTCAACGACTTGTACGACTACTTGGAGACC
GGGCCTCCCGTGTACTTTGTCGCCCGAGGAGCCGATGCGTCGCATCGGAGGGAGCAGCAGGCGCTCTGTTCGAGG
TTTACTTCGTGCCAGCCGCTGTCGGTGGCGAACACGCTCGAGCTGGAGAGGCAGCGGCCCGACGTATCCTACATC
GCCTCTCCCACAGCCAGCTGGATCGACGACTTCTTTCTCTGGCTGAACCCCATCTACGAGAACTGCTGCGTCGAG
GGCGGGTCGGCGTGCTTCGCGGGCCGGAGCCCTGCGTGGAACACGACGCTGTCGGGCATGCCGGAAGAGGAAGAA
TTCCTCCACTACCTCCACAAGTTCCTGACGTCGCCGGCCGACACGAGCTGCCCGCTGGGCGGTCAGGCCGCGTAC
GGAGAGGCGGTCGTCATCAACGACCGGAACACGGCGGTCCAGGCCAGCCACTTCCGGACGTCGCACACGCCGCTC
CGCAGCCAGGCCGACTTCATCAAGGCCTACTCCGCCGCGCGCCGCGTCGCGTCCGACATCAGCGAGAAGACGGGG
ACGGACGTGTTCCCCTACAGCCTCTTCTACATCTTCTTCGACCAGTACCTCAGCATCGTCGGGCTCACGGCGGGC
CTGCTGTGCGCGGCGGTCGGCATCATCTTCGTCATCGCGGCGCTGCTGCTGGGCTCGGCGCTGACGTCGGCGGTC
GTGACGGCGACGGTGGTGATGAGCGTGGTGGACATCATGGGGGCCATGGCGCTCTTCGACGTGTCGCTCAACGCG
GTGTCGCTGGTCAACCTGATCATCTGCGTGGGCATCTCGGTCGAGTTCTGCGCGCACATCGCGCGCGCCTTCATG
TTCCCGTCGCGCACCGTCATGGAGGGCAACAACAACGCGTTCCGCGGGCGCGACGCCCGGGCCTGGACGGCCCTC
GTCAACGTCGGCGGCTCCGTCTTCTCCGGCATCACCGTCACCAAGCTGCTCGGCGTCTGCGTCCTGGCCTTCACG
CGCTCCAAGATCTTCGAGATCTACTACTTCCGCGTCTGGCTCGCGCTCGTCGTCCTCGCCGCCCTGCACGCCCTC
GTCTTCCTGCCCGTCGCGCTCAGCCTCGCCGGCGGCGCCGGCTACGTCGACCCGGAGAGCGAGGGCACCGCGGCC
CAGGACCTGACGGACCGCCGGTGGCGGGCCATCCGCGTCCACGACCACAGCGACTCCGAGGACGGCTTCTGA
Transcript >Hirsu2|6782
ATGCGTCATCGCGTCGTCCCTCTCCTCGCGGCCGCGTCTCTGCCTCTACCCGGCATTGTTGCCGCCGCCGATTCT
CTCACGCCCAAACATGAGCCCGGCAGGTGTGCCTTCCGCGGCCAGTGCGGCAAGCAGAGCTTCTTCGGCAAGGAC
CTGCCATGCGTCGACAACGGGCCCGCTCAAGACCCCGAGCCGGAGCTCCGAAAGGAGCTCGTCGACCTGTGCGGC
GCCCAGTGGAGTGAGAGTCCGGTCTGCTGCACTCTCGAACAGGTCAAAAACCTCAAGTCCCAGCTCGGCACGCCC
AACACCATGATTGGCTCCTGTCCGGCCTGCAAGTACAACTTCTTCAACCTATTCTGCACCTTCACCTGCTCTCCC
GATCAGTCCCTCTTCGTCAATGTCACCAAGGCGGCCGACAAGAATGGCAAAAAGCTCGTCACCGAGCTCGATCAG
CTGATATCCGACGAATACGGCACCGGCTTCTACGACAGCTGCAAGGAGGTCAAGTTCGGCGGCGCAAACAGCAGG
GCCATGGACCTTATTGGCGGCGGTGCCAAGGACTACCATCAGCTGCTCAAGTTCCTGGGCGACGAGAGGCCCCTC
GTTGGCTCTCCCTTCCAGATCAACTTTCCTGACACGTACAGCCAGCCTGGAATGGGCCCTCTAGACATGCATCCA
AAGCAGTGCAACGACACAGACCCCGACTACCGCTGCGTCTGTGTTGATTGCCCCGAAGTGTGCCCCACGCTCCCT
GCTGTCGAAAAGCACGGCTCCTGCCGGGTCGGCGCCCTGCCTTGCTTGTCTTTTGCCTCCATCTTCACCTACTCG
GTCCTGCTCTTCGCCCTGGCCGCCTTTGTCTTCGGCCACGTTGCGTGGAGGAGATACGCACGAAACCGTGTCGAG
AGGACGAGGCTCCTGCACGAGGCCTCGCACAGCGATGACGAAGATGAGGGCGGCCCTGTCTTGACCGAGGCGATG
CGTGACCGCCCGACGAAGCGATACTGGCTGAATGACAAGTGCGACAAGGCCTTCAACACGCTCGGCCACACCGCA
GCCCGCTTCCCCGGCCTCACGATTGGCGCCAGTCTGCTGGTCGTCGCCATTCTCAGTGCCGGATGGTTCAGGTTC
GACCTGGAACGGGAGCCGGCGCGGCTTTGGGTCAGCCCGACCTCGGCCGCCGCCCAGGAGAAAGAGTACTTTGAC
TCCAACTTTGGCCCCTTCTACCGCGCGGAGAAGGTCTTCCTCGTCAACGACAGCAACCCGGACGGGCCTGGGCCG
GTCCTGAGCTACGAGACGCTCAAGTGGTGGATCGGGGTGGAGCAGAGCGTTGACAAGATTGCCAGTCCCACGTTT
GGCGACAGCCTGCAGGACCTCTGCTTCAAGCCGGCCAACGACGCCTGTGTCGTGCAGTCTGTCACGGCCTACTGG
TGGGCTCGCGGCGGCTTCAGCTCCACGTCGTGGAGGGATCAGCTGCGCAGCTGCGCCAGGTCTCCCGTCAACTGC
CGGCCGAAATTCGGCCAGCCGATCGAGCCCAACATGATATTGGGCGGATATGGCGACGACGTGACCGATGCTCGC
GCCATCACGGTAACGTGGGTGGTCAACAATGCGCAGGAGGGCACCGGCGCCCTGGCTAGGGCCATCGATTGGGAG
AACGCCCTCCGTGATCGGTTGCTCAAGGTACAGGACGAGGCCAAGGATCGAGGGCTCCGACTCTCCTTCACCACG
GAGATCAGCCTGGAGCAAGAACTCAACAAGTCGACAAACACCGACGCCAAGATCGTCGTCATCAGCTACGTCGTC
ATGTTCATCTACGCCTGCATGGCGCTGGGCACGCCTCTGAAGCATGTCTTCCGGAACCCCGCCCTGCTGCTCGTC
GAGTCCAAGGTGACACTGGGCCTGGTCGGCATCGTCATCGTCCTCATGTCCATTGCCGCCTCCATCGGCTTCTTC
TCCTGGGTCGGCCTCAAGGCCACCCTCATCATCGTCGAGGTGATACCCTTCATCGTCCTGGCCGTCGGCGTCGAC
AACATCTTCCTCATCGTGCATGAGCTGGAGAGGGTCAACGTGAGCTGCCCCGACCAGATGGTGGAGGAGCGCGTG
GCGAGAGCCCTCGGCCGCATGGGCCCGTCCATCCTCTTCTCCGCCCTGACGGAGACGGTCGCGTTCGCACTGGGA
GCAGCGGTTGGCATGCCTGCCGTCAGGAACTTTGCCGCCTACGCCGCCGGAGCCGTGTTTGTCAACGCCATTCTG
CAGATGACCATGTTCGTCTCCTTCCTCGCCCTGAACCAGATGCGGGTCGAAGACCATCGGTGCGAGCTCTGGCCG
TGGTGGCAAGTAACCAAGGCCCGCGTGCACATCGACGGCACCAACGGCTTCGTCTCCGGCGTGAGAGGCACGCAC
GTCGACGAAGAGAGCCTCCTGCAAGTCTTCATCAAGAACACGTACGCCCCGCGTCTGCTCGGCAAGAAGGTCAAG
CTCGGCGTCGTCACCATCTTCTTCGGCGTCTTCGCCGCCGCCTTAGCGCTCCTGCCCCAGGTGCAGCTCGGGCTG
GACCAGCGCGTGGCGATCCCGGACGGCTCGTATCTCATTCCCTACTTCAACGACTTGTACGACTACTTGGAGACC
GGGCCTCCCGTGTACTTTGTCGCCCGAGGAGCCGATGCGTCGCATCGGAGGGAGCAGCAGGCGCTCTGTTCGAGG
TTTACTTCGTGCCAGCCGCTGTCGGTGGCGAACACGCTCGAGCTGGAGAGGCAGCGGCCCGACGTATCCTACATC
GCCTCTCCCACAGCCAGCTGGATCGACGACTTCTTTCTCTGGCTGAACCCCATCTACGAGAACTGCTGCGTCGAG
GGCGGGTCGGCGTGCTTCGCGGGCCGGAGCCCTGCGTGGAACACGACGCTGTCGGGCATGCCGGAAGAGGAAGAA
TTCCTCCACTACCTCCACAAGTTCCTGACGTCGCCGGCCGACACGAGCTGCCCGCTGGGCGGTCAGGCCGCGTAC
GGAGAGGCGGTCGTCATCAACGACCGGAACACGGCGGTCCAGGCCAGCCACTTCCGGACGTCGCACACGCCGCTC
CGCAGCCAGGCCGACTTCATCAAGGCCTACTCCGCCGCGCGCCGCGTCGCGTCCGACATCAGCGAGAAGACGGGG
ACGGACGTGTTCCCCTACAGCCTCTTCTACATCTTCTTCGACCAGTACCTCAGCATCGTCGGGCTCACGGCGGGC
CTGCTGTGCGCGGCGGTCGGCATCATCTTCGTCATCGCGGCGCTGCTGCTGGGCTCGGCGCTGACGTCGGCGGTC
GTGACGGCGACGGTGGTGATGAGCGTGGTGGACATCATGGGGGCCATGGCGCTCTTCGACGTGTCGCTCAACGCG
GTGTCGCTGGTCAACCTGATCATCTGCGTGGGCATCTCGGTCGAGTTCTGCGCGCACATCGCGCGCGCCTTCATG
TTCCCGTCGCGCACCGTCATGGAGGGCAACAACAACGCGTTCCGCGGGCGCGACGCCCGGGCCTGGACGGCCCTC
GTCAACGTCGGCGGCTCCGTCTTCTCCGGCATCACCGTCACCAAGCTGCTCGGCGTCTGCGTCCTGGCCTTCACG
CGCTCCAAGATCTTCGAGATCTACTACTTCCGCGTCTGGCTCGCGCTCGTCGTCCTCGCCGCCCTGCACGCCCTC
GTCTTCCTGCCCGTCGCGCTCAGCCTCGCCGGCGGCGCCGGCTACGTCGACCCGGAGAGCGAGGGCACCGCGGCC
CAGGACCTGACGGACCGCCGGTGGCGGGCCATCCGCGTCCACGACCACAGCGACTCCGAGGACGGCTTCTGA
Gene >Hirsu2|6782
ATGCGTCATCGCGTCGTCCCTCTCCTCGCGGCCGCGTCTCTGCCTCTACCCGGCATTGTTGCCGCCGCCGATTCT
CTCACGCCCAAACATGAGCCCGGCAGGTGTGCCTTCCGCGGCCAGTGCGGCAAGCAGAGCTTCTTCGGCAAGGAC
CTGCCATGCGTCGACAACGGGCCCGCTCAAGACCCCGAGCCGGAGCTCCGAAAGGAGCTCGTCGACCTGTGCGGC
GCCCAGTGGAGTGAGAGTCCGGTCTGCTGCACTCTCGAACAGGTATTTCTGCCGCGGATGGCTCAGCCACGGGCC
GCACCGGGCCGAGCAATGGGCCTCCATGGACGCTGACCGTTTGCTCGCCAGGTCAAAAACCTCAAGTCCCAGCTC
GGCACGCCCAACACCATGATTGGCTCCTGTCCGGCCTGCAAGTACAACTTCTTCAACCTATTCTGCACCTTCACC
TGCTCTCCCGATCAGTCCCTCTTCGTCAATGTCACCAAGGCGGCCGACAAGAATGGCAAAAAGCTCGTCACCGAG
CTCGATCAGCTGATATCCGACGAATACGGCACCGGCTTCTACGACAGCTGCAAGGAGGTCAAGTTCGGCGGCGCA
AACAGCAGGGCCATGGACCTTATTGGCGGCGGTGCCAAGGACTACCATCAGCTGCTCAAGTTCCTGGGCGACGAG
AGGCCCCTCGTTGGCTCTCCCTTCCAGATCAACTTTCCTGACACGTACAGCCAGCCTGGAATGGGCCCTCTAGAC
ATGCATCCAAAGCAGTGCAACGACACAGACCCCGACTACCGCTGCGTCTGTGTTGATTGCCCCGAAGTGTGCCCC
ACGCTCCCTGCTGTCGAAAAGCACGGCTCCTGCCGGGTCGGCGCCCTGCCTTGCTTGTCTTTTGCCTCCATCTTC
ACCTACTCGGTCCTGCTCTTCGCCCTGGCCGCCTTTGTCTTCGGCCACGTTGCGTGGAGGAGATACGCACGAAAC
CGTGTCGAGAGGACGAGGCTCCTGCACGAGGCCTCGCACAGCGATGACGAAGATGAGGGCGGCCCTGTCTTGACC
GAGGCGATGCGTGACCGCCCGACGAAGCGATACTGGCTGAATGACAAGTGCGACAAGGCCTTCAACACGCTCGGC
CACACCGCAGCCCGCTTCCCCGGCCTCACGATTGGCGCCAGTCTGCTGGTCGTCGCCATTCTCAGTGCCGGATGG
TTCAGGTTCGACCTGGAACGGGAGCCGGCGCGGCTTTGGGTCAGCCCGACCTCGGCCGCCGCCCAGGAGAAAGAG
TACTTTGACTCCAACTTTGGCCCCTTCTACCGCGCGGAGAAGGTCTTCCTCGTCAACGACAGCAACCCGGACGGG
CCTGGGCCGGTCCTGAGCTACGAGACGCTCAAGTGGTGGATCGGGGTGGAGCAGAGCGTTGACAAGATTGCCAGT
CCCACGTTTGGCGACAGCCTGCAGGACCTCTGCTTCAAGCCGGCCAACGACGCCTGTGTCGTGCAGTCTGTCACG
GCCTACTGGTGGGCTCGCGGCGGCTTCAGCTCCACGTCGTGGAGGGATCAGCTGCGCAGCTGCGCCAGGTCTCCC
GTCAACTGCCGGCCGAAATTCGGCCAGCCGATCGAGCCCAACATGATATTGGGCGGATATGGCGACGACGTGACC
GATGCTCGCGCCATCACGGTAACGTGGGTGGTCAACAATGCGCAGGAGGGCACCGGCGCCCTGGCTAGGGCCATC
GATTGGGAGAACGCCCTCCGTGATCGGTTGCTCAAGGTACAGGACGAGGCCAAGGATCGAGGGCTCCGACTCTCC
TTCACCACGGAGATCAGCCTGGAGCAAGAACTCAACAAGTCGACAAACACCGACGCCAAGATCGTCGTCATCAGC
TACGTCGTCATGTTCATCTACGCCTGCATGGCGCTGGGCACGCCTCTGAAGCATGTCTTCCGGAACCCCGCCCTG
CTGCTCGTCGAGTCCAAGGTGACACTGGGCCTGGTCGGCATCGTCATCGTCCTCATGTCCATTGCCGCCTCCATC
GGCTTCTTCTCCTGGGTCGGCCTCAAGGCCACCCTCATCATCGTCGAGGTGATACCCTTCATCGTCCTGGCCGTC
GGCGTCGACAACATCTTCCTCATCGTGCATGAGCTGGAGAGGGTCAACGTGAGCTGCCCCGACCAGATGGTGGAG
GAGCGCGTGGCGAGAGCCCTCGGCCGCATGGGCCCGTCCATCCTCTTCTCCGCCCTGACGGAGACGGTCGCGTTC
GCACTGGGAGCAGCGGTTGGCATGCCTGCCGTCAGGAACTTTGCCGCCTACGCCGCCGGAGCCGTGTTTGTCAAC
GCCATTCTGCAGATGACCATGTTCGTCTCCTTCCTCGCCCTGAACCAGATGCGGGTCGAAGACCATCGGTGCGAG
CTCTGGCCGTGGTGGCAAGTAACCAAGGCCCGCGTGCACATCGACGGCACCAACGGCTTCGTCTCCGGCGTGAGA
GGCACGCACGTCGACGAAGAGAGCCTCCTGCAAGTCTTCATCAAGAACACGTACGCCCCGCGTCTGCTCGGCAAG
AAGGTCAAGCTCGGCGTCGTCACCATCTTCTTCGGCGTCTTCGCCGCCGCCTTAGCGCTCCTGCCCCAGGTGCAG
CTCGGGCTGGACCAGCGCGTGGCGATCCCGGACGGCTCGTATCTCATTCCCTACTTCAACGACTTGTACGACTAC
TTGGAGACCGGGCCTCCCGTGTACTTTGTCGCCCGAGGAGCCGATGCGTCGCATCGGAGGGAGCAGCAGGCGCTC
TGTTCGAGGTTTACTTCGTGCCAGCCGCTGTCGGTGGCGAACACGCTCGAGCTGGAGAGGCAGCGGCCCGACGTA
TCCTACATCGCCTCTCCCACAGCCAGCTGGATCGACGACTTCTTTCTCTGGCTGAACCCCATCTACGAGAACTGC
TGCGTCGAGGGCGGGTCGGCGTGCTTCGCGGGCCGGAGCCCTGCGTGGAACACGACGCTGTCGGGCATGCCGGAA
GAGGAAGAATTCCTCCACTACCTCCACAAGTTCCTGACGTCGCCGGCCGACACGAGCTGCCCGCTGGGCGGTCAG
GCCGCGTACGGAGAGGCGGTCGTCATCAACGACCGGAACACGGCGGTCCAGGCCAGCCACTTCCGGACGTCGCAC
ACGCCGCTCCGCAGCCAGGCCGACTTCATCAAGGCCTACTCCGCCGCGCGCCGCGTCGCGTCCGACATCAGCGAG
AAGACGGGGACGGACGTGTTCCCCTACAGCCTCTTCTACATCTTCTTCGACCAGTACCTCAGCATCGTCGGGCTC
ACGGCGGGCCTGCTGTGCGCGGCGGTCGGCATCATCTTCGTCATCGCGGCGCTGCTGCTGGGCTCGGCGCTGACG
TCGGCGGTCGTGACGGCGACGGTGGTGATGAGCGTGGTGGACATCATGGGGGCCATGGCGCTCTTCGACGTGTCG
CTCAACGCGGTGTCGCTGGTCAACCTGATCATCTGCGTGGGCATCTCGGTCGAGTTCTGCGCGCACATCGCGCGC
GCCTTCATGTTCCCGTCGCGCACCGTCATGGAGGGCAACAACAACGCGTTCCGCGGGCGCGACGCCCGGGCCTGG
ACGGCCCTCGTCAACGTCGGCGGCTCCGTCTTCTCCGGCATCACCGTCACCAAGCTGCTCGGCGTCTGCGTCCTG
GCCTTCACGCGCTCCAAGATCTTCGAGATCTACTACTTCCGCGTCTGGCTCGCGCTCGTCGTCCTCGCCGCCCTG
CACGCCCTCGTCTTCCTGCCCGTCGCGCTCAGCCTCGCCGGCGGCGCCGGCTACGTCGACCCGGAGAGCGAGGGC
ACCGCGGCCCAGGACCTGACGGACCGCCGGTGGCGGGCCATCCGCGTCCACGACCACAGCGACTCCGAGGACGGC
TTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail