Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6780
Gene name
LocationContig_361:12752..13743
Strand+
Gene length (bp)991
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05648 PEX11 Peroxisomal biogenesis factor 11 (PEX11) 1.2E-19 7 253

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005779 integral component of peroxisomal membrane Yes
GO:0016559 peroxisome fission Yes
GO:0044446 intracellular organelle part No
GO:0009987 cellular process No
GO:0031231 intrinsic component of peroxisomal membrane No
GO:0044439 peroxisomal part No
GO:0044424 intracellular part No
GO:0016021 integral component of membrane No
GO:0016043 cellular component organization No
GO:0071840 cellular component organization or biogenesis No
GO:0048285 organelle fission No
GO:0006996 organelle organization No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0044425 membrane part No
GO:0044438 microbody part No
GO:0031301 integral component of organelle membrane No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0044422 organelle part No
GO:0031300 intrinsic component of organelle membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 231 253 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6780
MVGVARQFVAFGTDIVGIERFLRLIQASLAILTAYPSLPLRPPAPAPALARLQTQLNLTRRTVRLFWFLDNLRAS
AGGRDGWLGVLAQSAFGLFGLVESATLLDLAGAGVTLLGAREAQRLDDEAQVLWLVALCASAALSASRLLALYAY
RAVPLLDQDGGDEKMLQRERDGDDDDDDDDDDMKQQKKKELEQRKAAAADAFAAEAAALATKLLADLLDTLLPAS
RIGLVALGAGPVGVAMLGSTLLSGWAVWNRCGRQLRGA*
Coding >Hirsu2|6780
ATGGTGGGCGTGGCCCGGCAGTTCGTCGCCTTCGGGACGGACATTGTGGGCATCGAGCGCTTCCTGCGCCTCATC
CAAGCCAGCCTCGCCATCCTAACCGCCTACCCGTCGCTGCCGCTCCGGCCGCCGGCGCCGGCGCCGGCGCTGGCC
CGGCTACAGACGCAGCTGAACCTGACGCGGCGCACCGTCCGCCTCTTCTGGTTCCTCGACAACCTGCGGGCCAGC
GCGGGCGGCCGCGACGGCTGGCTCGGCGTGCTGGCCCAGTCGGCCTTTGGCCTCTTCGGCCTCGTCGAGTCGGCC
ACGCTGCTCGACCTGGCCGGCGCCGGCGTCACGCTGCTGGGCGCGCGCGAGGCCCAGCGCCTCGACGACGAGGCC
CAGGTCCTGTGGCTCGTCGCGCTGTGCGCCTCGGCCGCGCTGTCCGCCTCCCGCCTGCTGGCCCTGTATGCCTAC
CGCGCCGTGCCGCTGCTGGACCAGGACGGCGGCGATGAGAAGATGCTGCAGCGGGAGAGGGACGGCGACGACGAC
GACGACGACGACGACGACGATATGAAGCAGCAGAAGAAGAAGGAGCTGGAGCAGCGCAAGGCCGCAGCGGCCGAC
GCCTTCGCCGCCGAGGCCGCCGCCCTCGCCACCAAGCTCCTGGCCGACCTGCTGGACACGCTGCTGCCGGCCTCG
AGGATCGGCTTGGTCGCGCTCGGCGCCGGGCCCGTCGGCGTCGCCATGCTGGGCAGCACCCTGCTCAGCGGCTGG
GCCGTCTGGAACCGCTGTGGGCGGCAGCTCCGGGGCGCGTGA
Transcript >Hirsu2|6780
ATGGTGGGCGTGGCCCGGCAGTTCGTCGCCTTCGGGACGGACATTGTGGGCATCGAGCGCTTCCTGCGCCTCATC
CAAGCCAGCCTCGCCATCCTAACCGCCTACCCGTCGCTGCCGCTCCGGCCGCCGGCGCCGGCGCCGGCGCTGGCC
CGGCTACAGACGCAGCTGAACCTGACGCGGCGCACCGTCCGCCTCTTCTGGTTCCTCGACAACCTGCGGGCCAGC
GCGGGCGGCCGCGACGGCTGGCTCGGCGTGCTGGCCCAGTCGGCCTTTGGCCTCTTCGGCCTCGTCGAGTCGGCC
ACGCTGCTCGACCTGGCCGGCGCCGGCGTCACGCTGCTGGGCGCGCGCGAGGCCCAGCGCCTCGACGACGAGGCC
CAGGTCCTGTGGCTCGTCGCGCTGTGCGCCTCGGCCGCGCTGTCCGCCTCCCGCCTGCTGGCCCTGTATGCCTAC
CGCGCCGTGCCGCTGCTGGACCAGGACGGCGGCGATGAGAAGATGCTGCAGCGGGAGAGGGACGGCGACGACGAC
GACGACGACGACGACGACGATATGAAGCAGCAGAAGAAGAAGGAGCTGGAGCAGCGCAAGGCCGCAGCGGCCGAC
GCCTTCGCCGCCGAGGCCGCCGCCCTCGCCACCAAGCTCCTGGCCGACCTGCTGGACACGCTGCTGCCGGCCTCG
AGGATCGGCTTGGTCGCGCTCGGCGCCGGGCCCGTCGGCGTCGCCATGCTGGGCAGCACCCTGCTCAGCGGCTGG
GCCGTCTGGAACCGCTGTGGGCGGCAGCTCCGGGGCGCGTGA
Gene >Hirsu2|6780
ATGGTGGGCGTGGCCCGGCAGTTCGTCGCCTTCGGGACGGACATTGGTATGGATCGCCCCGCTCGCGGCCCCGTC
CCCGGCCCTCGCCCGTTTTGTGTCCGTTTTGGCTCGAGTGAGGGAGAAAAGATAAGGGGTTAAGAGGATGGAGAA
AGGGAGAGAGGGTAGGAAGTGAGAGAGAGGGGGGGAAGGAGAGGGAGTGAGAGAGTGTGTGAGTGAGAGCATCGA
GTTCTGACACTTGCGGGCAGTGGGCATCGAGCGCTTCCTGCGCCTCATCCAAGCCAGCCTCGCCATCCTAACCGC
CTACCCGTCGCTGCCGCTCCGGCCGCCGGCGCCGGCGCCGGCGCTGGCCCGGCTACAGACGCAGCTGAACCTGAC
GCGGCGCACCGTCCGCCTCTTCTGGTTCCTCGACAACCTGCGGGCCAGCGCGGGCGGCCGCGACGGCTGGCTCGG
CGTGCTGGCCCAGTCGGCCTTTGGCCTCTTCGGCCTCGTCGAGTCGGCCACGCTGCTCGACCTGGCCGGCGCCGG
CGTCACGCTGCTGGGCGCGCGCGAGGCCCAGCGCCTCGACGACGAGGCCCAGGTCCTGTGGCTCGTCGCGCTGTG
CGCCTCGGCCGCGCTGTCCGCCTCCCGCCTGCTGGCCCTGTATGCCTACCGCGCCGTGCCGCTGCTGGACCAGGA
CGGCGGCGATGAGAAGATGCTGCAGCGGGAGAGGGACGGCGACGACGACGACGACGACGACGACGACGATATGAA
GCAGCAGAAGAAGAAGGAGCTGGAGCAGCGCAAGGCCGCAGCGGCCGACGCCTTCGCCGCCGAGGCCGCCGCCCT
CGCCACCAAGCTCCTGGCCGACCTGCTGGACACGCTGCTGCCGGCCTCGAGGATCGGCTTGGTCGCGCTCGGCGC
CGGGCCCGTCGGCGTCGCCATGCTGGGCAGCACCCTGCTCAGCGGCTGGGCCGTCTGGAACCGCTGTGGGCGGCA
GCTCCGGGGCGCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail