Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|678
Gene name
LocationContig_1136:7883..8467
Strand+
Gene length (bp)584
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02585 PIG-L GlcNAc-PI de-N-acetylase 4.8E-16 39 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4K9|GPI12_ARTBC N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03399 PE=3 SV=1 30 110 2.0E-35
sp|Q9Y2B2|PIGL_HUMAN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Homo sapiens GN=PIGL PE=1 SV=1 37 109 2.0E-15
sp|Q54C64|PIGL_DICDI Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Dictyostelium discoideum GN=pigl PE=3 SV=1 32 105 2.0E-14
sp|Q5SX19|PIGL_MOUSE N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Mus musculus GN=Pigl PE=2 SV=1 37 98 2.0E-14
sp|Q9HDW9|GPI12_SCHPO Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi12 PE=3 SV=1 36 110 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4K9|GPI12_ARTBC N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03399 PE=3 SV=1 30 110 2.0E-35
sp|Q9Y2B2|PIGL_HUMAN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Homo sapiens GN=PIGL PE=1 SV=1 37 109 2.0E-15
sp|Q54C64|PIGL_DICDI Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Dictyostelium discoideum GN=pigl PE=3 SV=1 32 105 2.0E-14
sp|Q5SX19|PIGL_MOUSE N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Mus musculus GN=Pigl PE=2 SV=1 37 98 2.0E-14
sp|Q9HDW9|GPI12_SCHPO Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi12 PE=3 SV=1 36 110 3.0E-14
sp|O35790|PIGL_RAT N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Rattus norvegicus GN=Pigl PE=2 SV=1 37 109 4.0E-14
sp|P23797|GPI12_YEAST N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI12 PE=1 SV=2 1 93 5.0E-14
sp|A6QQ24|PIGL_BOVIN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Bos taurus GN=PIGL PE=2 SV=1 37 109 9.0E-13
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|678
MDRALGLVATLAVVVPLLYVYTASVVQTRFPTLRNKRICLLIAHPDDEAMFFAPTVLALTRPETGNHVKILCLST
GNADGLGETRKKELVKSGMQLGLRDEDDVFVVDNPGNKGHGSS*
Coding >Hirsu2|678
ATGGACCGCGCGCTGGGCCTCGTGGCCACGCTGGCGGTGGTGGTGCCCTTGCTGTACGTCTACACGGCCAGCGTG
GTGCAGACGCGCTTCCCGACGCTGCGGAACAAGCGCATCTGCCTGCTGATTGCCCACCCAGACGACGAGGCCATG
TTCTTTGCGCCGACAGTCCTGGCCCTGACGCGGCCCGAAACGGGGAACCACGTCAAGATCCTGTGTCTGAGCACC
GGCAACGCGGACGGGCTCGGCGAGACGCGCAAGAAGGAGCTCGTCAAGAGCGGCATGCAGCTGGGCCTGCGCGAC
GAGGATGACGTCTTCGTCGTCGACAACCCGGGCAATAAGGGCCACGGCAGCAGCTGA
Transcript >Hirsu2|678
ATGGACCGCGCGCTGGGCCTCGTGGCCACGCTGGCGGTGGTGGTGCCCTTGCTGTACGTCTACACGGCCAGCGTG
GTGCAGACGCGCTTCCCGACGCTGCGGAACAAGCGCATCTGCCTGCTGATTGCCCACCCAGACGACGAGGCCATG
TTCTTTGCGCCGACAGTCCTGGCCCTGACGCGGCCCGAAACGGGGAACCACGTCAAGATCCTGTGTCTGAGCACC
GGCAACGCGGACGGGCTCGGCGAGACGCGCAAGAAGGAGCTCGTCAAGAGCGGCATGCAGCTGGGCCTGCGCGAC
GAGGATGACGTCTTCGTCGTCGACAACCCGGGCAATAAGGGCCACGGCAGCAGCTGA
Gene >Hirsu2|678
ATGGACCGCGCGCTGGGCCTCGTGGCCACGCTGGCGGTGGTGGTGCCCTTGCTGTACGTCTACACGGCCAGCGTG
GTGCAGACGCGCTTCCCGACGCTGCGGAACAAGCGCATCTGCCTGCTGATTGCCCACCCAGACGACGAGGCCATG
TTCTTTGCGCCGACAGTCCTGGCCCTGACGCGGCCCGAAACGGGGAACCACGTCAAGATCCTGTGTCTGAGCACC
GGTAGGCCGGCCCTCCCACCTCTTCCTGCTATGTGTCCGCCCGCCCCCCTTCTCGCTCTCTGTCTCTCGCTGTCC
GCACGCGCGAGGGAGAGAAGGCCAGAGGGGGGGGATAAGGCGCGAGGAGCTCCGTCCACGGAACAATCGGGGCTG
ACGGCTCGCCCGGGCAGGCAACGCGGACGGGCTCGGCGAGACGCGCAAGAAGGAGCTCGTCAAGAGCGGCATGCA
GCTGGGCCTGCGCGACGAGGATGACGTCTTCGTCGTCGACAACCCGTACGTTCTTTTTTGTTTTTTTCGTCAACC
CCCCCTTCGCGAAAGAAGCGGCGGCGAAAAGGGGCAATAAGGGCCACGGCAGCAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail