Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|678
Gene name
LocationContig_1136:7883..8467
Strand+
Gene length (bp)584
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02585 PIG-L GlcNAc-PI de-N-acetylase 8.5E-16 39 109

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4K9|GPI12_ARTBC N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03399 PE=3 SV=1 30 110 2.0E-35
sp|Q9Y2B2|PIGL_HUMAN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Homo sapiens GN=PIGL PE=1 SV=1 37 109 2.0E-15
sp|Q54C64|PIGL_DICDI Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Dictyostelium discoideum GN=pigl PE=3 SV=1 32 105 2.0E-14
sp|Q5SX19|PIGL_MOUSE N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Mus musculus GN=Pigl PE=2 SV=1 37 98 2.0E-14
sp|Q9HDW9|GPI12_SCHPO Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi12 PE=3 SV=1 36 110 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4K9|GPI12_ARTBC N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03399 PE=3 SV=1 30 110 2.0E-35
sp|Q9Y2B2|PIGL_HUMAN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Homo sapiens GN=PIGL PE=1 SV=1 37 109 2.0E-15
sp|Q54C64|PIGL_DICDI Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Dictyostelium discoideum GN=pigl PE=3 SV=1 32 105 2.0E-14
sp|Q5SX19|PIGL_MOUSE N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Mus musculus GN=Pigl PE=2 SV=1 37 98 2.0E-14
sp|Q9HDW9|GPI12_SCHPO Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi12 PE=3 SV=1 36 110 3.0E-14
sp|O35790|PIGL_RAT N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Rattus norvegicus GN=Pigl PE=2 SV=1 37 109 4.0E-14
sp|P23797|GPI12_YEAST N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI12 PE=1 SV=2 1 93 5.0E-14
sp|A6QQ24|PIGL_BOVIN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Bos taurus GN=PIGL PE=2 SV=1 37 109 9.0E-13
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.0975 0.2397 0.3403 0.0367 0.2922 0.0999 0.8815 0.1968 0.1616 0.1841

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 4 26 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5516
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2104
Ophiocordyceps australis map64 (Brazil) OphauB2|1914
Ophiocordyceps camponoti-floridani Ophcf2|01722
Ophiocordyceps kimflemingae Ophio5|7947
Ophiocordyceps subramaniannii Hirsu2|678 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|678
MDRALGLVATLAVVVPLLYVYTASVVQTRFPTLRNKRICLLIAHPDDEAMFFAPTVLALTRPETGNHVKILCLST
GNADGLGETRKKELVKSGMQLGLRDEDDVFVVDNPGNKGHGSS*
Coding >Hirsu2|678
ATGGACCGCGCGCTGGGCCTCGTGGCCACGCTGGCGGTGGTGGTGCCCTTGCTGTACGTCTACACGGCCAGCGTG
GTGCAGACGCGCTTCCCGACGCTGCGGAACAAGCGCATCTGCCTGCTGATTGCCCACCCAGACGACGAGGCCATG
TTCTTTGCGCCGACAGTCCTGGCCCTGACGCGGCCCGAAACGGGGAACCACGTCAAGATCCTGTGTCTGAGCACC
GGCAACGCGGACGGGCTCGGCGAGACGCGCAAGAAGGAGCTCGTCAAGAGCGGCATGCAGCTGGGCCTGCGCGAC
GAGGATGACGTCTTCGTCGTCGACAACCCGGGCAATAAGGGCCACGGCAGCAGCTGA
Transcript >Hirsu2|678
ATGGACCGCGCGCTGGGCCTCGTGGCCACGCTGGCGGTGGTGGTGCCCTTGCTGTACGTCTACACGGCCAGCGTG
GTGCAGACGCGCTTCCCGACGCTGCGGAACAAGCGCATCTGCCTGCTGATTGCCCACCCAGACGACGAGGCCATG
TTCTTTGCGCCGACAGTCCTGGCCCTGACGCGGCCCGAAACGGGGAACCACGTCAAGATCCTGTGTCTGAGCACC
GGCAACGCGGACGGGCTCGGCGAGACGCGCAAGAAGGAGCTCGTCAAGAGCGGCATGCAGCTGGGCCTGCGCGAC
GAGGATGACGTCTTCGTCGTCGACAACCCGGGCAATAAGGGCCACGGCAGCAGCTGA
Gene >Hirsu2|678
ATGGACCGCGCGCTGGGCCTCGTGGCCACGCTGGCGGTGGTGGTGCCCTTGCTGTACGTCTACACGGCCAGCGTG
GTGCAGACGCGCTTCCCGACGCTGCGGAACAAGCGCATCTGCCTGCTGATTGCCCACCCAGACGACGAGGCCATG
TTCTTTGCGCCGACAGTCCTGGCCCTGACGCGGCCCGAAACGGGGAACCACGTCAAGATCCTGTGTCTGAGCACC
GGTAGGCCGGCCCTCCCACCTCTTCCTGCTATGTGTCCGCCCGCCCCCCTTCTCGCTCTCTGTCTCTCGCTGTCC
GCACGCGCGAGGGAGAGAAGGCCAGAGGGGGGGGATAAGGCGCGAGGAGCTCCGTCCACGGAACAATCGGGGCTG
ACGGCTCGCCCGGGCAGGCAACGCGGACGGGCTCGGCGAGACGCGCAAGAAGGAGCTCGTCAAGAGCGGCATGCA
GCTGGGCCTGCGCGACGAGGATGACGTCTTCGTCGTCGACAACCCGTACGTTCTTTTTTGTTTTTTTCGTCAACC
CCCCCTTCGCGAAAGAAGCGGCGGCGAAAAGGGGCAATAAGGGCCACGGCAGCAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail