Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6779
Gene name
LocationContig_361:10706..12289
Strand+
Gene length (bp)1583
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01512 Complex1_51K Respiratory-chain NADH dehydrogenase 51 Kd subunit 1.6E-46 82 255
PF10589 NADH_4Fe-4S NADH-ubiquinone oxidoreductase-F iron-sulfur binding region 2.0E-29 371 453
PF10531 SLBB SLBB domain 3.6E-09 281 331

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92406|NDUV1_ASPNG NADH-ubiquinone oxidoreductase 51 kDa subunit, mitochondrial OS=Aspergillus niger GN=NUO51 PE=3 SV=1 18 485 0.0E+00
sp|P29913|NQO1_PARDE NADH-quinone oxidoreductase chain 1 OS=Paracoccus denitrificans GN=nqo1 PE=1 SV=1 37 463 0.0E+00
sp|A8EXI1|NUOF_RICCK NADH-quinone oxidoreductase subunit F OS=Rickettsia canadensis (strain McKiel) GN=nuoF PE=3 SV=1 37 455 0.0E+00
sp|A8GM77|NUOF_RICAH NADH-quinone oxidoreductase subunit F OS=Rickettsia akari (strain Hartford) GN=nuoF PE=3 SV=1 37 459 0.0E+00
sp|O07948|NUOF_RHOCA NADH-quinone oxidoreductase subunit F OS=Rhodobacter capsulatus GN=nuoF PE=3 SV=1 37 457 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92406|NDUV1_ASPNG NADH-ubiquinone oxidoreductase 51 kDa subunit, mitochondrial OS=Aspergillus niger GN=NUO51 PE=3 SV=1 18 485 0.0E+00
sp|P29913|NQO1_PARDE NADH-quinone oxidoreductase chain 1 OS=Paracoccus denitrificans GN=nqo1 PE=1 SV=1 37 463 0.0E+00
sp|A8EXI1|NUOF_RICCK NADH-quinone oxidoreductase subunit F OS=Rickettsia canadensis (strain McKiel) GN=nuoF PE=3 SV=1 37 455 0.0E+00
sp|A8GM77|NUOF_RICAH NADH-quinone oxidoreductase subunit F OS=Rickettsia akari (strain Hartford) GN=nuoF PE=3 SV=1 37 459 0.0E+00
sp|O07948|NUOF_RHOCA NADH-quinone oxidoreductase subunit F OS=Rhodobacter capsulatus GN=nuoF PE=3 SV=1 37 457 0.0E+00
sp|Q92JB2|NUOF_RICCN NADH-quinone oxidoreductase subunit F OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoF PE=3 SV=1 37 457 0.0E+00
sp|A8GQT6|NUOF_RICRS NADH-quinone oxidoreductase subunit F OS=Rickettsia rickettsii (strain Sheila Smith) GN=nuoF PE=2 SV=1 37 459 0.0E+00
sp|Q4UKA6|NUOF_RICFE NADH-quinone oxidoreductase subunit F OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoF PE=3 SV=1 37 459 0.0E+00
sp|Q68XY3|NUOF_RICTY NADH-quinone oxidoreductase subunit F OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoF PE=3 SV=1 37 458 0.0E+00
sp|P56912|NUOF1_RHIME NADH-quinone oxidoreductase subunit F 1 OS=Rhizobium meliloti (strain 1021) GN=nuoF1 PE=3 SV=1 37 462 0.0E+00
sp|Q9ZE33|NUOF_RICPR NADH-quinone oxidoreductase subunit F OS=Rickettsia prowazekii (strain Madrid E) GN=nuoF PE=3 SV=1 37 458 0.0E+00
sp|A8F0M0|NUOF_RICM5 NADH-quinone oxidoreductase subunit F OS=Rickettsia massiliae (strain Mtu5) GN=nuoF PE=3 SV=1 37 459 0.0E+00
sp|Q1RHA0|NUOF_RICBR NADH-quinone oxidoreductase subunit F OS=Rickettsia bellii (strain RML369-C) GN=nuoF PE=3 SV=1 37 456 0.0E+00
sp|Q9FNN5|NDUV1_ARATH NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Arabidopsis thaliana GN=At5g08530 PE=2 SV=1 31 447 0.0E+00
sp|Q54I90|NDUV1_DICDI NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Dictyostelium discoideum GN=ndufv1 PE=2 SV=1 1 458 0.0E+00
sp|P25708|NDUV1_BOVIN NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Bos taurus GN=NDUFV1 PE=1 SV=2 30 455 0.0E+00
sp|Q0MQI4|NDUV1_PONPY NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Pongo pygmaeus GN=NDUFV1 PE=2 SV=1 30 458 0.0E+00
sp|Q0MQI5|NDUV1_GORGO NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFV1 PE=2 SV=1 1 458 0.0E+00
sp|Q8HXQ9|NDUV1_MACFA NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Macaca fascicularis GN=NDUFV1 PE=2 SV=1 15 458 0.0E+00
sp|P49821|NDUV1_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens GN=NDUFV1 PE=1 SV=4 30 458 0.0E+00
sp|Q0MQI6|NDUV1_PANTR NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Pan troglodytes GN=NDUFV1 PE=2 SV=1 30 458 0.0E+00
sp|Q91YT0|NDUV1_MOUSE NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Mus musculus GN=Ndufv1 PE=1 SV=1 30 461 0.0E+00
sp|P24917|NDUV1_NEUCR NADH-ubiquinone oxidoreductase 51 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-51 PE=2 SV=2 1 485 0.0E+00
sp|A8GYE0|NUOF_RICB8 NADH-quinone oxidoreductase subunit F OS=Rickettsia bellii (strain OSU 85-389) GN=nuoF PE=3 SV=1 37 456 0.0E+00
sp|P56913|NUOF2_RHIME NADH-quinone oxidoreductase subunit F 2 OS=Rhizobium meliloti (strain 1021) GN=nuoF2 PE=3 SV=2 76 456 4.0E-126
sp|P65568|NUOF_MYCBO NADH-quinone oxidoreductase subunit F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nuoF PE=3 SV=1 76 456 2.0E-123
sp|P9WIV6|NUOF_MYCTO NADH-quinone oxidoreductase subunit F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nuoF PE=3 SV=1 76 456 2.0E-123
sp|P9WIV7|NUOF_MYCTU NADH-quinone oxidoreductase subunit F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nuoF PE=1 SV=1 76 456 2.0E-123
sp|Q56222|NQO1_THET8 NADH-quinone oxidoreductase subunit 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo1 PE=1 SV=1 60 448 6.0E-115
sp|Q9XAQ9|NUOF_STRCO NADH-quinone oxidoreductase subunit F OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nuoF PE=3 SV=1 55 455 6.0E-115
sp|P33901|NUOF_SALTY NADH-quinone oxidoreductase subunit F OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nuoF PE=3 SV=2 76 453 1.0E-100
sp|P31979|NUOF_ECOLI NADH-quinone oxidoreductase subunit F OS=Escherichia coli (strain K12) GN=nuoF PE=1 SV=3 76 453 2.0E-100
sp|Q89AU2|NUOF_BUCBP NADH-quinone oxidoreductase subunit F OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nuoF PE=3 SV=1 55 457 2.0E-100
sp|Q8K9Y3|NUOF_BUCAP NADH-quinone oxidoreductase subunit F OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nuoF PE=3 SV=1 78 453 3.0E-100
sp|Q9I0J7|NUOF_PSEAE NADH-quinone oxidoreductase subunit F OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nuoF PE=3 SV=1 68 469 4.0E-98
sp|P57256|NUOF_BUCAI NADH-quinone oxidoreductase subunit F OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nuoF PE=3 SV=1 78 453 2.0E-96
sp|O94500|NDUV1_SCHPO NADH-ubiquinone oxidoreductase 51 kDa subunit homolog SPBC18E5.10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18E5.10 PE=3 SV=1 42 456 9.0E-92
sp|O66841|NUOF_AQUAE NADH-quinone oxidoreductase subunit F OS=Aquifex aeolicus (strain VF5) GN=nuoF PE=3 SV=1 78 452 9.0E-92
sp|Q46507|HNDC_DESFR NADP-reducing hydrogenase subunit HndC OS=Desulfovibrio fructosivorans GN=hndC PE=1 SV=1 78 456 1.0E-84
sp|P22317|HOXF_CUPNH NAD-reducing hydrogenase HoxS subunit alpha OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hoxF PE=1 SV=1 69 475 8.0E-61
sp|D5ARZ1|RNFC_RHOCB Electron transport complex subunit RnfC OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=rnfC PE=3 SV=1 76 320 2.0E-07
sp|Q52716|RNFC_RHOCA Electron transport complex subunit RnfC OS=Rhodobacter capsulatus GN=rnfC PE=1 SV=1 76 320 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0051539 4 iron, 4 sulfur cluster binding Yes
GO:0048037 cofactor binding No
GO:0051540 metal cluster binding No
GO:0051536 iron-sulfur cluster binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6779
MLSSRAAPSKAVSLSRTAVRGLATVQDGTPKRTYGGLKDQDRIFQNLYGRLPADLKSAKRMGDWHKTKEIILKGH
DWIISEIKASGLRGRGGAGFPSGLKWSFMNFKDWDKDSKPRYLVVNADEGEPGTCKDREIMRKDPHKLVEGCLVA
GRAMNATAAYIYIRGEFVHEAAVLQNAINEAYKDGLIGKNACDSGYDFDVFLHRGAGAYVCGEETSLIESLEGKP
GKPRLKPPFPAAVGLFGCPSTVANVETVAVAPTICRRGGSWFAGFGRERNQGTKLFCISGHVNNPCTVEEEMSIP
LRELIEKHCGGVRGGWDNLLAIIPGGSSTPILPKNICDEQLMDFDALKDSQSGLGTAAVIVMDKSADVVRAIARL
SHFYRHESCGQCTPCREGSKWTEQIMQRFEKGQGREREIDMLQELTKQVEGHTICALGEAFAWPIQGLIRHFRPE
LEARMQSFAKQSGGPALAGGWDRDTRAQGKLVSPGQ*
Coding >Hirsu2|6779
ATGCTGTCCTCGAGAGCGGCGCCGAGCAAGGCTGTCAGCCTCTCGCGGACCGCCGTGAGGGGCCTCGCCACCGTC
CAGGACGGCACGCCCAAGCGGACCTACGGCGGCCTGAAGGACCAGGACCGCATCTTCCAGAACCTGTATGGCCGG
CTGCCCGCCGACCTCAAGAGCGCCAAGCGAATGGGCGACTGGCACAAGACAAAGGAGATCATCCTCAAGGGCCAC
GACTGGATCATCAGCGAGATCAAGGCCTCGGGCCTGCGAGGACGGGGTGGCGCCGGCTTCCCCTCCGGCCTGAAA
TGGTCTTTCATGAACTTCAAGGACTGGGACAAGGACAGCAAGCCTAGATACCTGGTCGTCAACGCCGACGAGGGC
GAGCCCGGCACGTGCAAGGACCGCGAGATCATGCGCAAGGACCCCCACAAGCTTGTCGAGGGCTGTCTCGTCGCC
GGCCGAGCCATGAACGCGACGGCCGCCTACATCTACATCCGCGGCGAGTTCGTCCACGAAGCCGCCGTCCTGCAG
AACGCCATCAACGAGGCGTACAAGGACGGGCTGATAGGCAAGAACGCCTGCGACTCGGGCTACGACTTCGACGTC
TTCCTCCACCGCGGTGCCGGCGCCTACGTCTGCGGCGAAGAGACGTCTCTCATCGAGTCGCTCGAGGGCAAGCCG
GGCAAGCCGCGCCTCAAGCCTCCCTTCCCCGCCGCCGTCGGCCTCTTCGGCTGCCCGTCGACGGTGGCCAACGTC
GAGACGGTGGCCGTGGCGCCGACCATCTGCCGCCGCGGCGGCAGCTGGTTCGCCGGCTTCGGCCGCGAGCGGAAC
CAGGGCACCAAGCTGTTCTGCATCTCGGGCCACGTCAACAACCCGTGCACCGTCGAGGAGGAGATGTCGATCCCG
CTGCGCGAGCTCATCGAGAAGCACTGCGGCGGCGTGCGCGGCGGCTGGGACAACCTGCTGGCCATCATCCCGGGA
GGCTCCTCGACGCCGATCCTGCCCAAGAACATCTGCGACGAGCAGCTGATGGACTTTGACGCCCTCAAGGACAGC
CAGTCCGGCCTGGGGACCGCCGCCGTCATCGTCATGGACAAGAGCGCCGACGTCGTCCGGGCGATTGCTCGGCTG
AGCCACTTCTACCGCCATGAGAGCTGCGGCCAGTGCACGCCGTGCCGCGAGGGAAGCAAGTGGACGGAGCAGATC
ATGCAACGGTTCGAGAAGGGCCAGGGGCGCGAGCGCGAGATCGACATGCTGCAAGAGTTGACGAAGCAGGTCGAG
GGCCACACCATCTGCGCCTTGGGAGAGGCGTTTGCCTGGCCCATCCAGGGCCTCATCCGCCACTTCCGGCCGGAG
CTGGAGGCGAGGATGCAGAGCTTCGCCAAGCAGAGCGGCGGCCCGGCACTGGCCGGCGGCTGGGATCGCGACACC
AGGGCCCAGGGGAAGCTGGTTTCCCCCGGCCAATAG
Transcript >Hirsu2|6779
ATGCTGTCCTCGAGAGCGGCGCCGAGCAAGGCTGTCAGCCTCTCGCGGACCGCCGTGAGGGGCCTCGCCACCGTC
CAGGACGGCACGCCCAAGCGGACCTACGGCGGCCTGAAGGACCAGGACCGCATCTTCCAGAACCTGTATGGCCGG
CTGCCCGCCGACCTCAAGAGCGCCAAGCGAATGGGCGACTGGCACAAGACAAAGGAGATCATCCTCAAGGGCCAC
GACTGGATCATCAGCGAGATCAAGGCCTCGGGCCTGCGAGGACGGGGTGGCGCCGGCTTCCCCTCCGGCCTGAAA
TGGTCTTTCATGAACTTCAAGGACTGGGACAAGGACAGCAAGCCTAGATACCTGGTCGTCAACGCCGACGAGGGC
GAGCCCGGCACGTGCAAGGACCGCGAGATCATGCGCAAGGACCCCCACAAGCTTGTCGAGGGCTGTCTCGTCGCC
GGCCGAGCCATGAACGCGACGGCCGCCTACATCTACATCCGCGGCGAGTTCGTCCACGAAGCCGCCGTCCTGCAG
AACGCCATCAACGAGGCGTACAAGGACGGGCTGATAGGCAAGAACGCCTGCGACTCGGGCTACGACTTCGACGTC
TTCCTCCACCGCGGTGCCGGCGCCTACGTCTGCGGCGAAGAGACGTCTCTCATCGAGTCGCTCGAGGGCAAGCCG
GGCAAGCCGCGCCTCAAGCCTCCCTTCCCCGCCGCCGTCGGCCTCTTCGGCTGCCCGTCGACGGTGGCCAACGTC
GAGACGGTGGCCGTGGCGCCGACCATCTGCCGCCGCGGCGGCAGCTGGTTCGCCGGCTTCGGCCGCGAGCGGAAC
CAGGGCACCAAGCTGTTCTGCATCTCGGGCCACGTCAACAACCCGTGCACCGTCGAGGAGGAGATGTCGATCCCG
CTGCGCGAGCTCATCGAGAAGCACTGCGGCGGCGTGCGCGGCGGCTGGGACAACCTGCTGGCCATCATCCCGGGA
GGCTCCTCGACGCCGATCCTGCCCAAGAACATCTGCGACGAGCAGCTGATGGACTTTGACGCCCTCAAGGACAGC
CAGTCCGGCCTGGGGACCGCCGCCGTCATCGTCATGGACAAGAGCGCCGACGTCGTCCGGGCGATTGCTCGGCTG
AGCCACTTCTACCGCCATGAGAGCTGCGGCCAGTGCACGCCGTGCCGCGAGGGAAGCAAGTGGACGGAGCAGATC
ATGCAACGGTTCGAGAAGGGCCAGGGGCGCGAGCGCGAGATCGACATGCTGCAAGAGTTGACGAAGCAGGTCGAG
GGCCACACCATCTGCGCCTTGGGAGAGGCGTTTGCCTGGCCCATCCAGGGCCTCATCCGCCACTTCCGGCCGGAG
CTGGAGGCGAGGATGCAGAGCTTCGCCAAGCAGAGCGGCGGCCCGGCACTGGCCGGCGGCTGGGATCGCGACACC
AGGGCCCAGGGGAAGCTGGTTTCCCCCGGCCAATAG
Gene >Hirsu2|6779
ATGCTGTCCTCGAGAGCGGCGCCGAGCAAGGCTGTCAGCCTCTCGCGGACCGCCGTGAGGGGCCTCGCCACCGTC
CAGGACGGCACGCCCAAGCGGACCTACGGCGGCCTGAAGGACCAGGACCGCATCTTCCAGAACCTGTATGGCCGG
CTGCCCGCCGACCTCAAGAGCGCCAAGCGAATGGGCGACTGGCACAAGACAAAGGAGATCATCCTCAAGGGCCAC
GACTGGATCATCAGCGAGATCAAGGCCTCGGGCCTGCGAGGACGGGGTGGCGCCGGCTTCCCCTCCGGCCTGAAA
TGGGTGCGTCTGCCCTGCCCCGCCGCCGCCGCCGCGCGAGACATCTAACACGGCCGCTTGCCCGGCAGTCTTTCA
TGAACTTCAAGGACTGGGACAAGGACAGCAAGCCTAGATACCTGGTCGTCAACGCCGACGAGGGCGAGCCCGGCA
CGTGCAAGGACCGCGAGATCATGCGCAAGGACCCCCACAAGCTTGTCGAGGGCTGTCTCGTCGCCGGCCGAGCCA
TGAACGCGACGGCCGCCTACATCTACATCCGCGGCGAGTTCGTCCACGAAGCCGCCGTCCTGCAGAACGCCATCA
ACGAGGCGTACAAGGACGGGCTGATAGGCAAGAACGCCTGCGACTCGGGCTACGACTTCGACGTCTTCCTCCACC
GCGGTGCCGGCGCCTACGTCTGCGGCGAAGAGACGTCTCTCATCGAGTCGCTCGAGGGCAAGCCGGGCAAGCCGC
GCCTCAAGCCTCCCTTCCCCGCCGCCGTCGGCCTCTTCGGCTGCCCGTCGACGGTGGCCAACGTCGAGACGGTGG
CCGTGGCGCCGACCATCTGCCGCCGCGGCGGCAGCTGGTTCGCCGGCTTCGGCCGCGAGCGGAACCAGGGCACCA
AGCTGTTCTGCATCTCGGGCCACGTCAACAACCCGTGCACCGTCGAGGAGGAGATGTCGATCCCGCTGCGCGAGC
TCATCGAGAAGCACTGCGGCGGCGTGCGCGGCGGCTGGGACAACCTGCTGGCCATCATCCCGGGAGGCTCCTCGA
CGCCGATCCTGCCCAAGAACATCTGCGACGAGCAGCTGATGGACTTTGACGCCCTCAAGGACAGCCAGTCCGGCC
TGGGGACCGCCGCCGTCATCGTCATGGACAAGAGCGCCGACGTCGTCCGGGCGATTGCTCGGCTGAGCCACTTCT
ACCGCCATGAGAGCTGCGGCCAGTGCACGCCGTGCCGCGAGGGAAGCAAGTGGACGGAGCAGATCATGCAACGGT
TCGAGAAGGGCCAGGGGCGCGAGCGCGAGATCGACATGCTGCAAGAGTTGACGAAGCAGGTCGAGGGCCACACCA
TCTGCGGTAAGCACCCGGACACCACCAGACCCACGATCCAGTGCACTGACTGTTGGCCGTCAGCCTTGGGAGAGG
CGTTTGCCTGGCCCATCCAGGGCCTCATCCGCCACTTCCGGCCGGAGCTGGAGGCGAGGATGCAGAGCTTCGCCA
AGCAGAGCGGCGGCCCGGCACTGGCCGGCGGCTGGGATCGCGACACCAGGGCCCAGGGGAAGCTGGTTTCCCCCG
GCCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail