Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6777
Gene name
LocationContig_361:7793..9484
Strand+
Gene length (bp)1691
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00465 Fe-ADH Iron-containing alcohol dehydrogenase 5.2E-104 79 474
PF13685 Fe-ADH_2 Iron-containing alcohol dehydrogenase 1.8E-12 83 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6QP15|HOT_BOVIN Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Bos taurus GN=ADHFE1 PE=2 SV=1 8 498 1.0E-165
sp|Q4QQW3|HOT_RAT Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Rattus norvegicus GN=Adhfe1 PE=1 SV=1 14 498 4.0E-165
sp|Q8R0N6|HOT_MOUSE Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Mus musculus GN=Adhfe1 PE=1 SV=2 14 498 3.0E-164
sp|Q08B39|HOT_XENLA Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus laevis GN=adhfe1 PE=2 SV=1 18 498 8.0E-162
sp|Q6P371|HOT_XENTR Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus tropicalis GN=adhfe1 PE=2 SV=1 62 498 1.0E-161
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6QP15|HOT_BOVIN Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Bos taurus GN=ADHFE1 PE=2 SV=1 8 498 1.0E-165
sp|Q4QQW3|HOT_RAT Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Rattus norvegicus GN=Adhfe1 PE=1 SV=1 14 498 4.0E-165
sp|Q8R0N6|HOT_MOUSE Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Mus musculus GN=Adhfe1 PE=1 SV=2 14 498 3.0E-164
sp|Q08B39|HOT_XENLA Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus laevis GN=adhfe1 PE=2 SV=1 18 498 8.0E-162
sp|Q6P371|HOT_XENTR Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus tropicalis GN=adhfe1 PE=2 SV=1 62 498 1.0E-161
sp|Q5RF11|HOT_PONAB Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Pongo abelii GN=ADHFE1 PE=2 SV=1 14 498 1.0E-160
sp|Q8IWW8|HOT_HUMAN Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Homo sapiens GN=ADHFE1 PE=1 SV=1 18 498 3.0E-160
sp|Q17EN4|HOT_AEDAE Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Aedes aegypti GN=AAEL003729 PE=3 SV=1 14 497 2.0E-153
sp|Q7Q547|HOT_ANOGA Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Anopheles gambiae GN=AGAP006646 PE=3 SV=3 14 497 4.0E-152
sp|Q9W265|HOT_DROME Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Drosophila melanogaster GN=T3dh PE=2 SV=1 60 498 3.0E-146
sp|Q28XT3|HOT_DROPS Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA17444 PE=3 SV=2 60 497 2.0E-145
sp|A8WTJ7|HOT_CAEBR Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Caenorhabditis briggsae GN=CBG02769 PE=3 SV=1 65 497 2.0E-137
sp|Q9U2M4|HOT_CAEEL Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Caenorhabditis elegans GN=Y38F1A.6 PE=3 SV=1 65 497 4.0E-135
sp|Q54GJ7|HOT_DICDI Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Dictyostelium discoideum GN=adhfe1 PE=3 SV=1 69 497 6.0E-135
sp|P31005|MEDH_BACMT NAD-dependent methanol dehydrogenase OS=Bacillus methanolicus GN=mdh PE=1 SV=3 83 461 7.0E-48
sp|A4IP64|ADH1_GEOTN Long-chain-alcohol dehydrogenase 1 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=adh1 PE=1 SV=1 84 497 2.0E-44
sp|P76553|EUTG_ECOLI Ethanolamine utilization protein EutG OS=Escherichia coli (strain K12) GN=eutG PE=3 SV=2 84 442 4.0E-40
sp|P45513|DHAT_CITFR 1,3-propanediol dehydrogenase OS=Citrobacter freundii GN=dhaT PE=3 SV=1 83 452 4.0E-40
sp|Q59477|DHAT_KLEPN 1,3-propanediol dehydrogenase OS=Klebsiella pneumoniae GN=dhaT PE=1 SV=1 83 452 6.0E-40
sp|P71017|GBSB_BACSU Alcohol dehydrogenase OS=Bacillus subtilis (strain 168) GN=gbsB PE=1 SV=2 66 441 6.0E-37
sp|P41795|EUTG_SALTY Ethanolamine utilization protein EutG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=eutG PE=3 SV=2 84 466 2.0E-36
sp|P0A9S1|FUCO_ECOLI Lactaldehyde reductase OS=Escherichia coli (strain K12) GN=fucO PE=1 SV=2 83 466 6.0E-35
sp|P0A9S2|FUCO_ECO57 Lactaldehyde reductase OS=Escherichia coli O157:H7 GN=fucO PE=3 SV=2 83 466 6.0E-35
sp|P0DJA2|ADH2_ZYMMO Alcohol dehydrogenase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adhB PE=1 SV=1 82 496 1.0E-34
sp|P37686|ADH2_ECOLI Probable alcohol dehydrogenase OS=Escherichia coli (strain K12) GN=yiaY PE=3 SV=4 76 497 3.0E-34
sp|F8DVL8|ADH2_ZYMMA Alcohol dehydrogenase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=adhB PE=3 SV=1 82 496 6.0E-34
sp|Q09669|ADH4_SCHPO Alcohol dehydrogenase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adh4 PE=2 SV=1 3 497 1.0E-32
sp|P38945|4HDB_CLOK5 NAD-dependent 4-hydroxybutyrate dehydrogenase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=4hbD PE=3 SV=1 140 473 6.0E-31
sp|A6ZTT5|ADH4_YEAS7 Alcohol dehydrogenase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=ADH4 PE=3 SV=2 83 494 2.0E-29
sp|P10127|ADH4_YEAST Alcohol dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH4 PE=1 SV=3 83 494 2.0E-28
sp|Q04944|ADHA_CLOAB NADH-dependent butanol dehydrogenase A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=bdhA PE=1 SV=2 79 470 3.0E-28
sp|Q9F282|ADHA_THEET Long-chain primary alcohol dehydrogenase AdhA OS=Thermoanaerobacter ethanolicus GN=adhA PE=1 SV=1 74 497 1.0E-26
sp|P13604|ADH1_CLOSA NADPH-dependent butanol dehydrogenase OS=Clostridium saccharobutylicum GN=adh1 PE=3 SV=1 81 494 1.0E-26
sp|Q24803|ADH2_ENTHI Aldehyde-alcohol dehydrogenase 2 OS=Entamoeba histolytica GN=ADH2 PE=1 SV=1 102 399 9.0E-25
sp|P0A9Q7|ADHE_ECOLI Aldehyde-alcohol dehydrogenase OS=Escherichia coli (strain K12) GN=adhE PE=1 SV=2 99 452 5.0E-24
sp|P0A9Q8|ADHE_ECO57 Aldehyde-alcohol dehydrogenase OS=Escherichia coli O157:H7 GN=adhE PE=3 SV=2 99 452 5.0E-24
sp|Q9RCG0|MNO_AMYME Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase OS=Amycolatopsis methanolica GN=mno PE=1 SV=1 83 418 6.0E-24
sp|O05239|YUGJ_BACSU Probable NADH-dependent butanol dehydrogenase 1 OS=Bacillus subtilis (strain 168) GN=yugJ PE=3 SV=1 79 472 7.0E-23
sp|Q04945|ADHB_CLOAB NADH-dependent butanol dehydrogenase B OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=bdhB PE=1 SV=1 79 466 3.0E-22
sp|C5MRT8|MNO_MYCS8 Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase OS=Mycobacterium sp. (strain DSM 3803 / JC1) PE=1 SV=1 83 421 6.0E-22
sp|P33744|ADHE_CLOAB Aldehyde-alcohol dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=adhE PE=2 SV=3 102 407 1.0E-21
sp|Q53062|MNO_RHOER Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase OS=Rhodococcus erythropolis GN=thcE PE=1 SV=2 84 421 2.0E-20
sp|O05240|YUGK_BACSU Probable NADH-dependent butanol dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=yugK PE=3 SV=1 79 463 3.0E-19
sp|A4ISB9|ADH2_GEOTN Long-chain-alcohol dehydrogenase 2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=adh2 PE=1 SV=1 79 463 4.0E-18
sp|Q46856|YQHD_ECOLI Alcohol dehydrogenase YqhD OS=Escherichia coli (strain K12) GN=yqhD PE=1 SV=1 100 463 9.0E-17
sp|Q24857|ADH3_ENTHI Alcohol dehydrogenase 3 OS=Entamoeba histolytica GN=ADH3 PE=2 SV=1 134 461 3.0E-15
sp|Q93T12|TFDF_DELAC Maleylacetate reductase OS=Delftia acidovorans GN=tfdF PE=1 SV=2 81 400 3.0E-15
sp|P27101|TCBF_PSESQ Maleylacetate reductase OS=Pseudomonas sp. (strain P51) GN=tcbF PE=3 SV=1 81 400 3.0E-15
sp|P94135|TFDF2_CUPPJ Maleylacetate reductase 2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdFII PE=1 SV=1 81 366 1.0E-12
sp|O30847|CLCE_PSEKB Maleylacetate reductase OS=Pseudomonas knackmussii (strain DSM 6978 / LMG 23759 / B13) GN=clcE PE=3 SV=1 71 459 5.0E-10
sp|O87612|CLCE_PSEAI Maleylacetate reductase OS=Pseudomonas aeruginosa GN=clcE PE=3 SV=1 71 459 8.0E-10
sp|P27137|TFDF1_CUPPJ Maleylacetate reductase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdFI PE=3 SV=1 72 409 8.0E-09
sp|O84992|MACA1_RHOOP Maleylacetate reductase 1 OS=Rhodococcus opacus GN=macA PE=3 SV=1 70 459 9.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6777
MVAPIRVVASPAKRASSLLRTIQYTHPPSCPCHSNPGYHGQSPPALVPRAADAGRRRRYATPVTGKSEQADYAFE
MAASSIRFGPGVTREVGMDFKNMGARRVCVVTDSTVDKLDAMRQVREGLTAEGINFDVYSDVRIEPKDSSIKDAI
AWVRPKDADAFLAVGGGSVIDTAKLMNLYSAYPDADFLDFVNAPLGKGRPVDKPLKPLIAVPTTAGTGSETTGTA
IFDLVAKRAKTGVAHRNLKPTLGICDPINTRTMPAAVKAASGLDVLCHSLESWTAIPYNQRTPRPPNPIMRPAYQ
GANPISDVFSLHALRSTIKYLPRAVRDPDDFEAQSQMLLAATLAGIGFGNAGVHLCHGMSYPISGQNPGYKHAGY
DVQSPIIPHGVSVAVSAPAVFRFTAASNPERHLQAAEAFGVDTSNVKKESAGEVLAEALTKFLADLGDQPKGLKD
LGFGTEHIDALVEGTIPQARVLMLAPGLSKELQAEKEQLRKLYEDAMKH*
Coding >Hirsu2|6777
ATGGTTGCCCCCATCCGAGTGGTCGCGAGCCCGGCCAAGCGGGCGTCCAGCCTGCTGCGCACGATCCAGTATACG
CACCCGCCGTCGTGCCCCTGCCACTCCAACCCAGGGTACCACGGGCAATCGCCGCCGGCGCTGGTCCCGCGTGCC
GCCGACGCCGGCCGCCGCCGGCGCTACGCGACCCCCGTCACCGGCAAGTCGGAGCAGGCCGACTATGCTTTCGAG
ATGGCCGCCTCGTCCATCCGCTTCGGCCCGGGCGTCACGCGCGAGGTCGGCATGGACTTCAAGAACATGGGCGCC
CGGAGGGTCTGCGTCGTCACCGACTCGACCGTCGACAAGCTCGACGCCATGCGCCAGGTCCGCGAGGGGCTCACG
GCCGAGGGCATCAACTTTGACGTCTATTCCGACGTCCGCATAGAGCCCAAGGACAGCTCCATCAAGGACGCCATT
GCGTGGGTCAGGCCCAAGGACGCCGACGCCTTCCTCGCCGTCGGTGGCGGCTCCGTCATAGACACGGCCAAGCTC
ATGAACCTCTATTCCGCCTACCCGGACGCCGACTTCCTCGACTTTGTCAACGCGCCGCTCGGCAAGGGCCGGCCC
GTCGACAAGCCCCTCAAGCCCCTCATCGCCGTCCCCACGACGGCCGGCACCGGCAGCGAGACGACCGGCACGGCC
ATCTTCGACCTCGTCGCCAAGCGGGCCAAGACGGGCGTCGCGCACCGGAACCTGAAGCCGACGCTCGGCATCTGC
GACCCCATCAACACGAGGACCATGCCGGCCGCCGTCAAGGCCGCCTCGGGCCTCGACGTCCTCTGCCACTCCCTC
GAGTCGTGGACCGCCATTCCCTACAATCAGCGGACTCCCAGGCCCCCCAACCCCATCATGCGCCCCGCCTATCAG
GGCGCGAACCCCATCTCCGACGTCTTCTCTCTCCACGCCCTCCGCAGCACCATCAAGTATCTGCCCCGTGCCGTG
AGGGATCCGGACGACTTTGAGGCCCAGAGCCAGATGCTGCTCGCCGCCACTCTGGCCGGCATCGGCTTCGGCAAC
GCGGGCGTGCATCTGTGTCACGGCATGTCCTATCCCATCTCCGGACAGAACCCGGGGTACAAGCATGCGGGCTAT
GACGTGCAATCCCCCATCATTCCCCATGGCGTGTCGGTCGCCGTCTCCGCCCCGGCCGTCTTCCGCTTCACGGCG
GCCTCGAACCCGGAGCGCCATCTTCAGGCGGCCGAGGCCTTTGGTGTCGACACTTCTAACGTCAAGAAGGAGAGC
GCGGGCGAGGTCCTGGCCGAGGCACTGACCAAGTTCCTCGCCGATCTCGGCGACCAGCCAAAGGGGCTGAAGGAC
CTGGGATTCGGCACCGAGCATATCGACGCGCTCGTCGAGGGCACCATCCCGCAGGCCCGCGTGCTGATGCTGGCT
CCGGGTCTATCGAAGGAGCTCCAGGCCGAGAAGGAACAGCTAAGAAAGCTGTACGAGGATGCCATGAAGCATTGA
Transcript >Hirsu2|6777
ATGGTTGCCCCCATCCGAGTGGTCGCGAGCCCGGCCAAGCGGGCGTCCAGCCTGCTGCGCACGATCCAGTATACG
CACCCGCCGTCGTGCCCCTGCCACTCCAACCCAGGGTACCACGGGCAATCGCCGCCGGCGCTGGTCCCGCGTGCC
GCCGACGCCGGCCGCCGCCGGCGCTACGCGACCCCCGTCACCGGCAAGTCGGAGCAGGCCGACTATGCTTTCGAG
ATGGCCGCCTCGTCCATCCGCTTCGGCCCGGGCGTCACGCGCGAGGTCGGCATGGACTTCAAGAACATGGGCGCC
CGGAGGGTCTGCGTCGTCACCGACTCGACCGTCGACAAGCTCGACGCCATGCGCCAGGTCCGCGAGGGGCTCACG
GCCGAGGGCATCAACTTTGACGTCTATTCCGACGTCCGCATAGAGCCCAAGGACAGCTCCATCAAGGACGCCATT
GCGTGGGTCAGGCCCAAGGACGCCGACGCCTTCCTCGCCGTCGGTGGCGGCTCCGTCATAGACACGGCCAAGCTC
ATGAACCTCTATTCCGCCTACCCGGACGCCGACTTCCTCGACTTTGTCAACGCGCCGCTCGGCAAGGGCCGGCCC
GTCGACAAGCCCCTCAAGCCCCTCATCGCCGTCCCCACGACGGCCGGCACCGGCAGCGAGACGACCGGCACGGCC
ATCTTCGACCTCGTCGCCAAGCGGGCCAAGACGGGCGTCGCGCACCGGAACCTGAAGCCGACGCTCGGCATCTGC
GACCCCATCAACACGAGGACCATGCCGGCCGCCGTCAAGGCCGCCTCGGGCCTCGACGTCCTCTGCCACTCCCTC
GAGTCGTGGACCGCCATTCCCTACAATCAGCGGACTCCCAGGCCCCCCAACCCCATCATGCGCCCCGCCTATCAG
GGCGCGAACCCCATCTCCGACGTCTTCTCTCTCCACGCCCTCCGCAGCACCATCAAGTATCTGCCCCGTGCCGTG
AGGGATCCGGACGACTTTGAGGCCCAGAGCCAGATGCTGCTCGCCGCCACTCTGGCCGGCATCGGCTTCGGCAAC
GCGGGCGTGCATCTGTGTCACGGCATGTCCTATCCCATCTCCGGACAGAACCCGGGGTACAAGCATGCGGGCTAT
GACGTGCAATCCCCCATCATTCCCCATGGCGTGTCGGTCGCCGTCTCCGCCCCGGCCGTCTTCCGCTTCACGGCG
GCCTCGAACCCGGAGCGCCATCTTCAGGCGGCCGAGGCCTTTGGTGTCGACACTTCTAACGTCAAGAAGGAGAGC
GCGGGCGAGGTCCTGGCCGAGGCACTGACCAAGTTCCTCGCCGATCTCGGCGACCAGCCAAAGGGGCTGAAGGAC
CTGGGATTCGGCACCGAGCATATCGACGCGCTCGTCGAGGGCACCATCCCGCAGGCCCGCGTGCTGATGCTGGCT
CCGGGTCTATCGAAGGAGCTCCAGGCCGAGAAGGAACAGCTAAGAAAGCTGTACGAGGATGCCATGAAGCATTGA
Gene >Hirsu2|6777
ATGGTTGCCCCCATCCGAGTGGTCGCGAGCGTGAGTTCCGCAACCGCCACCCCTGATCCTCCAACAACGAGTTGA
CCGTCTCCTTCAGCCGGCCAAGCGGGCGTCCAGCCTGCTGCGCACGATCCAGTATACGCACCCGCCGTCGTGCCC
CTGCCACTCCAACCCAGGGTACCACGGGCAATCGCCGCCGGCGCTGGTCCCGCGTGCCGCCGACGCCGGCCGCCG
CCGGCGCTACGCGACCCCCGTCACCGGCAAGTCGGAGCAGGCCGACTATGCTTTCGAGATGGCCGCCTCGTCCAT
CCGCTTCGGCCCGGGCGTCACGCGCGAGGTCGGCATGGACTTCAAGAACATGGGCGCCCGGAGGGTCTGCGTCGT
CACCGACTCGACCGTCGACAAGCTCGACGCCATGCGCCAGGTCCGCGAGGGGCTCACGGCCGAGGGCATCAACTT
TGACGTCTATTCCGACGTCCGCATAGAGCCCAAGGACAGCTCGTACGTTGGTGCCTCCTGCTCCTCCTCCTACTG
CTGCGAGCTGACGCCCGCCCGACTTGCCCCATCTGAAATAATCGCAGCATCAAGGACGCCATTGCGTGGGTCAGG
CCCAAGGACGCCGACGCCTTCCTCGCCGTCGGTGGCGGCTCCGTCATAGACACGGCCAAGCTCATGAACCTCTAT
TCCGCCTACCCGGACGCCGACTTCCTCGACTTTGTCAACGCGCCGCTCGGCAAGGGCCGGCCCGTCGACAAGCCC
CTCAAGCCCCTCATCGCCGTCCCCACGACGGCCGGCACCGGCAGCGAGACGACCGGCACGGCCATCTTCGACCTC
GTCGCCAAGCGGGCCAAGACGGGCGTCGCGCACCGGAACCTGAAGCCGACGCTCGGCATCTGCGACCCCATCAAC
ACGAGGACCATGCCGGCCGCCGTCAAGGCCGCCTCGGGCCTCGACGTCCTCTGCCACTCCCTCGAGTCGTGGACC
GCCATTCCCTACAATCAGCGGACTCCCAGGCCCCCCAACCCCATCATGCGCCCCGCCTATCAGGGCGCGAACCCC
ATCTCCGACGTCTTCTCTCTCCACGCCCTCCGCAGCACCATCAAGTATCTGCCCCGTGCCGTGAGGGATCCGGAC
GACTTTGAGGCCCAGAGCCAGATGCTGCTCGCCGCCACTCTGGCCGGCATCGGCTTCGGCAACGCGGGCGTGCAT
CTGTGTCACGGTACGTCACTGTGCCTCCTCGTGCGGCCTGGACTGACTTTGGATTGCTGGCAGGCATGTCCTATC
CCATCTCCGGACAGAACCCGGGGTACAAGCATGCGGGCTATGACGTGCAATCCCCCATCATTCCCCATGGCGTGT
CGGTCGCCGTCTCCGCCCCGGCCGTCTTCCGCTTCACGGCGGCCTCGAACCCGGAGCGCCATCTTCAGGCGGCCG
AGGCCTTTGGTGTCGACACTTCTAACGTCAAGAAGGAGAGCGCGGGCGAGGTCCTGGCCGAGGCACTGACCAAGT
TCCTCGCCGATCTCGGCGACCAGCCAAAGGGGCTGAAGGACCTGGGATTCGGCACCGAGCATATCGACGCGCTCG
TCGAGGGCACCATCCCGCAGGCCCGCGTGCTGATGCTGGCTCCGGGTCTATCGAAGGAGCTCCAGGCCGAGAAGG
AACAGCTAAGAAAGCTGTACGAGGATGCCATGAAGCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail