Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6773
Gene name
LocationContig_360:17537..19469
Strand+
Gene length (bp)1932
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01798 Nop snoRNA binding domain, fibrillarin 3.3E-79 171 404
PF08156 NOP5NT NOP5NT (NUC127) domain 6.8E-21 4 67

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7TIF5|NOP58_VANPO Nucleolar protein 58 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NOP58 PE=3 SV=1 4 447 0.0E+00
sp|Q8X066|NOP58_NEUCR Nucleolar protein 58 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nop-58 PE=3 SV=1 1 548 0.0E+00
sp|A6ZPE5|NOP58_YEAS7 Nucleolar protein 58 OS=Saccharomyces cerevisiae (strain YJM789) GN=NOP58 PE=3 SV=1 4 444 0.0E+00
sp|Q12499|NOP58_YEAST Nucleolar protein 58 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP58 PE=1 SV=1 4 444 0.0E+00
sp|Q6CKR8|NOP58_KLULA Nucleolar protein 58 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOP58 PE=3 SV=1 4 450 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7TIF5|NOP58_VANPO Nucleolar protein 58 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NOP58 PE=3 SV=1 4 447 0.0E+00
sp|Q8X066|NOP58_NEUCR Nucleolar protein 58 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nop-58 PE=3 SV=1 1 548 0.0E+00
sp|A6ZPE5|NOP58_YEAS7 Nucleolar protein 58 OS=Saccharomyces cerevisiae (strain YJM789) GN=NOP58 PE=3 SV=1 4 444 0.0E+00
sp|Q12499|NOP58_YEAST Nucleolar protein 58 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP58 PE=1 SV=1 4 444 0.0E+00
sp|Q6CKR8|NOP58_KLULA Nucleolar protein 58 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOP58 PE=3 SV=1 4 450 0.0E+00
sp|Q6CG46|NOP58_YARLI Nucleolar protein 58 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP58 PE=3 SV=1 4 452 0.0E+00
sp|A6QYH8|NOP58_AJECN Nucleolar protein 58 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=NOP58 PE=3 SV=1 1 447 0.0E+00
sp|Q1E1Q5|NOP58_COCIM Nucleolar protein 58 OS=Coccidioides immitis (strain RS) GN=NOP58 PE=3 SV=1 1 543 0.0E+00
sp|Q2UC04|NOP58_ASPOR Nucleolar protein 58 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nop58 PE=3 SV=1 1 543 0.0E+00
sp|A1D688|NOP58_NEOFI Nucleolar protein 58 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nop58 PE=3 SV=1 1 539 0.0E+00
sp|A1CL70|NOP58_ASPCL Nucleolar protein 58 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nop58 PE=3 SV=1 1 543 0.0E+00
sp|Q5B8G3|NOP58_EMENI Nucleolar protein 58 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nop58 PE=3 SV=1 1 582 0.0E+00
sp|Q0CQH1|NOP58_ASPTN Nucleolar protein 58 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nop58 PE=3 SV=1 1 543 0.0E+00
sp|Q4WYK9|NOP58_ASPFU Nucleolar protein 58 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nop58 PE=3 SV=1 1 539 0.0E+00
sp|A2QE38|NOP58_ASPNC Nucleolar protein 58 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nop58 PE=3 SV=1 1 543 0.0E+00
sp|A7F2R6|NOP58_SCLS1 Nucleolar protein 58 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=NOP58 PE=3 SV=1 3 455 0.0E+00
sp|A5E4V9|NOP58_LODEL Nucleolar protein 58 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NOP58 PE=3 SV=1 4 445 2.0E-180
sp|Q9P7S7|NOP58_SCHPO Nucleolar protein 58 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nop58 PE=1 SV=1 3 446 1.0E-177
sp|Q753I4|NOP58_ASHGO Nucleolar protein 58 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOP58 PE=3 SV=2 4 426 5.0E-171
sp|Q59S06|NOP58_CANAL Nucleolar protein 58 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NOP58 PE=3 SV=1 4 440 9.0E-171
sp|Q6FQ21|NOP58_CANGA Nucleolar protein 58 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOP58 PE=3 SV=1 4 440 2.0E-169
sp|A5DHW0|NOP58_PICGU Nucleolar protein 58 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NOP58 PE=3 SV=2 4 440 6.0E-164
sp|A3LUT0|NOP58_PICST Nucleolar protein 58 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NOP58 PE=3 SV=1 4 445 3.0E-161
sp|Q6BIX6|NOP58_DEBHA Nucleolar protein 58 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NOP58 PE=3 SV=2 4 440 2.0E-160
sp|P0CP26|NOP58_CRYNJ Nucleolar protein 58 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NOP58 PE=3 SV=1 3 408 8.0E-148
sp|P0CP27|NOP58_CRYNB Nucleolar protein 58 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NOP58 PE=3 SV=1 3 408 9.0E-148
sp|Q4PBF2|NOP58_USTMA Nucleolar protein 58 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NOP58 PE=3 SV=1 5 408 8.0E-146
sp|Q9MAB3|NOP5B_ARATH Probable nucleolar protein 5-2 OS=Arabidopsis thaliana GN=NOP5-2 PE=2 SV=1 3 412 1.0E-140
sp|Q9Y2X3|NOP58_HUMAN Nucleolar protein 58 OS=Homo sapiens GN=NOP58 PE=1 SV=1 3 410 5.0E-139
sp|Q4R779|NOP58_MACFA Nucleolar protein 58 OS=Macaca fascicularis GN=NOP58 PE=2 SV=1 3 410 1.0E-138
sp|Q6DFW4|NOP58_MOUSE Nucleolar protein 58 OS=Mus musculus GN=Nop58 PE=1 SV=1 3 410 3.0E-137
sp|O04658|NOP5A_ARATH Probable nucleolar protein 5-1 OS=Arabidopsis thaliana GN=NOP5-1 PE=2 SV=2 3 412 3.0E-137
sp|Q9QZ86|NOP58_RAT Nucleolar protein 58 OS=Rattus norvegicus GN=Nop58 PE=1 SV=1 3 410 2.0E-136
sp|Q55FI4|NOP58_DICDI Nucleolar protein 58 OS=Dictyostelium discoideum GN=nop58 PE=3 SV=1 3 379 2.0E-116
sp|O94514|NOP56_SCHPO Nucleolar protein 56 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nop56 PE=3 SV=1 1 380 5.0E-104
sp|O04656|NOP5C_ARATH Putative nucleolar protein 5-3 OS=Arabidopsis thaliana GN=NOP5-3 PE=3 SV=2 3 412 4.0E-101
sp|Q12460|NOP56_YEAST Nucleolar protein 56 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP56 PE=1 SV=1 4 413 5.0E-98
sp|O00567|NOP56_HUMAN Nucleolar protein 56 OS=Homo sapiens GN=NOP56 PE=1 SV=4 3 408 8.0E-97
sp|Q5RA29|NOP56_PONAB Nucleolar protein 56 OS=Pongo abelii GN=NOP56 PE=2 SV=1 3 408 1.0E-96
sp|Q3SZ63|NOP56_BOVIN Nucleolar protein 56 OS=Bos taurus GN=NOP56 PE=2 SV=1 3 408 8.0E-96
sp|Q9D6Z1|NOP56_MOUSE Nucleolar protein 56 OS=Mus musculus GN=Nop56 PE=1 SV=2 3 408 1.0E-95
sp|Q95K50|NOP56_MACFA Nucleolar protein 56 OS=Macaca fascicularis GN=NOP56 PE=2 SV=1 3 408 5.0E-95
sp|Q21276|YZVL_CAEEL Uncharacterized NOP5 family protein K07C5.4 OS=Caenorhabditis elegans GN=K07C5.4 PE=3 SV=1 4 379 3.0E-88
sp|Q54MT2|NOP56_DICDI Nucleolar protein 56 OS=Dictyostelium discoideum GN=nop56 PE=3 SV=1 1 381 9.0E-84
sp|Q58105|Y694_METJA Uncharacterized NOP5 family protein MJ0694 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0694 PE=1 SV=1 146 380 3.0E-47
sp|Q5U5C5|PRP31_XENLA U4/U6 small nuclear ribonucleoprotein Prp31 OS=Xenopus laevis GN=prpf31 PE=2 SV=1 164 383 6.0E-24
sp|Q6NVP6|PRP31_XENTR U4/U6 small nuclear ribonucleoprotein Prp31 OS=Xenopus tropicalis GN=prpf31 PE=2 SV=1 164 383 9.0E-24
sp|Q7SXM7|PRP31_DANRE U4/U6 small nuclear ribonucleoprotein Prp31 OS=Danio rerio GN=prpf31 PE=2 SV=1 164 378 2.0E-23
sp|Q8CCF0|PRP31_MOUSE U4/U6 small nuclear ribonucleoprotein Prp31 OS=Mus musculus GN=Prpf31 PE=1 SV=3 164 383 1.0E-22
sp|Q8WWY3|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 OS=Homo sapiens GN=PRPF31 PE=1 SV=2 164 383 5.0E-20
sp|O42904|PRP31_SCHPO Pre-mRNA-processing factor 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp31 PE=3 SV=1 164 411 2.0E-18
sp|P49704|PRP31_YEAST Pre-mRNA-processing factor 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP31 PE=1 SV=2 190 377 9.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6773
MSLFVLAETPAGYGLFKAADKKLFKNDDLAAELGRPEKLVEMLKLKKFVKFDSAAMALEEAASLRDGKVPALLTS
LLEDLKAEKKASLAVADTKLGTAISNLPQFNISPVSGSNTMDVFRGIREHLPSLIPGLAQENIDRMALGLSHSIS
RHKLKFSVDKIDSMIIQAIRLLDDMDKDLNVFAMRTKEWYGWHFPELAKILNDNLAYARLILAAGFRTNVAQTDL
SEILPEETEEAVKKAAEISMGTEITEDDLTNIKSLAEQVILYTEYRSQLSSYLESRMRAIAPNLTTLVGFLVGAR
LIAHAGSLMNLAKAPGSTIQILGAEKALFRALKTKHDTPKYGIIYHASLIGQATGRNKGKIARMLASRTALGLRV
DALANDDEEDEEQRSILGLTSRIKLENHLRRLEGKPLLPKGANVAPSGEITTSAQFSLKETRRYNVDADGVADAA
NGDTPKKIKGKKSKDVKKASAQADEEMKDAKDDDSDDSAGAVTTPANGKVAKLSSDEYERLAALAGLSAKKFKRK
YERGDVQLHTDGTPKVYSKKELKKLRKAGENGTPIKPETPSKAAAGSEKKKRKHEDEDAAEAKKEKKLKKKKRHS
EG*
Coding >Hirsu2|6773
ATGTCTCTCTTTGTTCTTGCCGAGACGCCCGCGGGCTACGGCCTGTTCAAGGCGGCGGACAAGAAGCTGTTTAAG
AATGACGACCTCGCGGCCGAACTCGGACGTCCGGAGAAGCTGGTGGAAATGCTGAAGCTCAAGAAGTTTGTCAAG
TTCGACAGCGCCGCCATGGCCCTCGAGGAGGCCGCATCGCTCAGGGACGGCAAAGTTCCGGCTCTGCTGACCTCG
CTGCTGGAGGATCTCAAGGCCGAGAAGAAGGCGTCGCTGGCGGTGGCCGACACAAAACTCGGCACGGCCATCTCA
AACCTGCCCCAGTTCAACATTTCGCCCGTGTCCGGCTCCAACACCATGGACGTCTTTCGTGGGATTCGAGAGCAC
CTGCCGTCCCTCATCCCGGGCCTCGCCCAGGAGAATATCGACCGGATGGCGCTCGGTCTCTCACATTCGATTTCC
CGGCACAAGCTCAAGTTTTCCGTCGACAAGATTGACTCGATGATCATCCAGGCCATCCGACTTCTCGACGACATG
GACAAGGATCTCAATGTCTTTGCCATGCGCACCAAGGAATGGTATGGCTGGCATTTCCCGGAACTGGCCAAGATC
CTCAACGACAACCTCGCCTATGCCCGCCTCATCTTGGCTGCCGGGTTCCGGACCAACGTCGCCCAGACCGATCTG
TCCGAGATCCTTCCCGAGGAGACGGAGGAGGCCGTCAAGAAGGCTGCCGAGATCAGCATGGGCACCGAAATCACG
GAAGACGATCTCACCAACATCAAGTCGCTGGCCGAGCAAGTGATTCTCTACACCGAGTACCGGTCACAACTCTCG
TCGTATCTGGAGAGCCGGATGCGGGCCATTGCTCCGAACCTGACGACGCTCGTCGGCTTCCTCGTCGGTGCGAGG
CTCATCGCCCATGCCGGCTCACTCATGAACCTGGCCAAGGCCCCCGGTTCGACCATCCAGATCCTCGGTGCGGAA
AAGGCCCTCTTCCGCGCCCTCAAGACGAAGCACGACACCCCCAAGTACGGCATCATCTACCACGCTTCTCTCATC
GGCCAGGCTACCGGGAGAAACAAGGGCAAGATCGCGCGTATGCTGGCGTCGAGAACAGCGCTGGGCCTCCGCGTG
GACGCCCTCGCCAACGACGACGAGGAGGATGAGGAGCAGAGGTCGATCCTGGGCCTCACCAGCCGCATCAAGCTC
GAGAACCACCTCCGCCGGCTCGAGGGAAAGCCTCTTCTGCCCAAGGGCGCCAACGTAGCACCTTCAGGCGAGATC
ACAACGTCGGCCCAGTTCAGTCTGAAGGAGACGCGGCGGTACAACGTCGACGCGGACGGCGTAGCCGATGCGGCC
AACGGCGACACGCCCAAGAAGATCAAGGGCAAGAAGTCCAAGGACGTCAAGAAGGCGTCGGCGCAGGCCGACGAA
GAGATGAAGGACGCCAAGGACGACGACTCGGACGACTCGGCTGGTGCGGTGACAACGCCGGCCAACGGCAAGGTC
GCCAAGCTGTCGAGCGACGAATACGAGCGCCTGGCCGCCCTGGCCGGCCTGTCGGCGAAGAAGTTCAAGCGAAAG
TACGAGAGGGGCGACGTGCAGCTGCACACGGACGGCACGCCCAAGGTCTACAGCAAGAAGGAGCTGAAGAAGCTG
CGCAAGGCGGGCGAGAACGGCACGCCGATCAAGCCGGAGACGCCGTCCAAGGCCGCGGCCGGGTCGGAGAAGAAG
AAGCGCAAGCACGAAGACGAAGACGCGGCCGAGGCCAAGAAGGAGAAGAAGCTGAAAAAGAAGAAGCGCCACTCG
GAGGGCTGA
Transcript >Hirsu2|6773
ATGTCTCTCTTTGTTCTTGCCGAGACGCCCGCGGGCTACGGCCTGTTCAAGGCGGCGGACAAGAAGCTGTTTAAG
AATGACGACCTCGCGGCCGAACTCGGACGTCCGGAGAAGCTGGTGGAAATGCTGAAGCTCAAGAAGTTTGTCAAG
TTCGACAGCGCCGCCATGGCCCTCGAGGAGGCCGCATCGCTCAGGGACGGCAAAGTTCCGGCTCTGCTGACCTCG
CTGCTGGAGGATCTCAAGGCCGAGAAGAAGGCGTCGCTGGCGGTGGCCGACACAAAACTCGGCACGGCCATCTCA
AACCTGCCCCAGTTCAACATTTCGCCCGTGTCCGGCTCCAACACCATGGACGTCTTTCGTGGGATTCGAGAGCAC
CTGCCGTCCCTCATCCCGGGCCTCGCCCAGGAGAATATCGACCGGATGGCGCTCGGTCTCTCACATTCGATTTCC
CGGCACAAGCTCAAGTTTTCCGTCGACAAGATTGACTCGATGATCATCCAGGCCATCCGACTTCTCGACGACATG
GACAAGGATCTCAATGTCTTTGCCATGCGCACCAAGGAATGGTATGGCTGGCATTTCCCGGAACTGGCCAAGATC
CTCAACGACAACCTCGCCTATGCCCGCCTCATCTTGGCTGCCGGGTTCCGGACCAACGTCGCCCAGACCGATCTG
TCCGAGATCCTTCCCGAGGAGACGGAGGAGGCCGTCAAGAAGGCTGCCGAGATCAGCATGGGCACCGAAATCACG
GAAGACGATCTCACCAACATCAAGTCGCTGGCCGAGCAAGTGATTCTCTACACCGAGTACCGGTCACAACTCTCG
TCGTATCTGGAGAGCCGGATGCGGGCCATTGCTCCGAACCTGACGACGCTCGTCGGCTTCCTCGTCGGTGCGAGG
CTCATCGCCCATGCCGGCTCACTCATGAACCTGGCCAAGGCCCCCGGTTCGACCATCCAGATCCTCGGTGCGGAA
AAGGCCCTCTTCCGCGCCCTCAAGACGAAGCACGACACCCCCAAGTACGGCATCATCTACCACGCTTCTCTCATC
GGCCAGGCTACCGGGAGAAACAAGGGCAAGATCGCGCGTATGCTGGCGTCGAGAACAGCGCTGGGCCTCCGCGTG
GACGCCCTCGCCAACGACGACGAGGAGGATGAGGAGCAGAGGTCGATCCTGGGCCTCACCAGCCGCATCAAGCTC
GAGAACCACCTCCGCCGGCTCGAGGGAAAGCCTCTTCTGCCCAAGGGCGCCAACGTAGCACCTTCAGGCGAGATC
ACAACGTCGGCCCAGTTCAGTCTGAAGGAGACGCGGCGGTACAACGTCGACGCGGACGGCGTAGCCGATGCGGCC
AACGGCGACACGCCCAAGAAGATCAAGGGCAAGAAGTCCAAGGACGTCAAGAAGGCGTCGGCGCAGGCCGACGAA
GAGATGAAGGACGCCAAGGACGACGACTCGGACGACTCGGCTGGTGCGGTGACAACGCCGGCCAACGGCAAGGTC
GCCAAGCTGTCGAGCGACGAATACGAGCGCCTGGCCGCCCTGGCCGGCCTGTCGGCGAAGAAGTTCAAGCGAAAG
TACGAGAGGGGCGACGTGCAGCTGCACACGGACGGCACGCCCAAGGTCTACAGCAAGAAGGAGCTGAAGAAGCTG
CGCAAGGCGGGCGAGAACGGCACGCCGATCAAGCCGGAGACGCCGTCCAAGGCCGCGGCCGGGTCGGAGAAGAAG
AAGCGCAAGCACGAAGACGAAGACGCGGCCGAGGCCAAGAAGGAGAAGAAGCTGAAAAAGAAGAAGCGCCACTCG
GAGGGCTGA
Gene >Hirsu2|6773
ATGTCTCTCTTTGTTCTTGCCGAGACGCCCGCGGGGTGAGTGGCCCGGCCTCGGCTCCGGACCGCGGCCGTAACT
GACAGGAATCACAGCTACGGCCTGTTCAAGGCGGCGGACAAGAAGCTGTTTAAGAATGACGACCTCGCGGCCGAA
CTCGGACGTCCGGAGAAGCTGGTGGAAATGTGAGAAGCTGGCCCGAACGGCCTTGGCCTTGTACATCCAGGCCGG
AGACTAATACGCGACATCTGCAGGCTGAAGCTCAAGAAGTTTGTCAAGTTCGACAGCGCCGCCATGGCCCTCGAG
GAGGCCGCATCGCTCAGGGACGGCAAAGTTCCGGCTCTGCTGACCTCGCTGCTGGAGGATCTCAAGGCCGAGAAG
AAGGCGTCGCTGGCGGTGGCCGACACAAAACTCGGCACGGCCATCTCAAACCTGCCCCAGTTCAACATTTCGCCC
GTGTCCGGCTCCAACACCATGGACGTCTTTCGTGGGATTCGAGAGCACCTGCCGTCCCTCATCCCGGGCCTCGCC
CAGGAGAATATCGACCGGATGGCGCTCGGTCTCTCACATTCGATTTCCCGGCACAAGCTCAAGTTTTCCGTCGAC
AAGATTGACTCGATGATCATCCAGGCCATCCGACTTCTCGACGACATGGACAAGGATCTCAATGTCTTTGCCATG
CGCACCAAGGAATGGTATGGCTGGCATTTCCCGGAACTGGCCAAGATCCTCAACGACAACCTCGCCTATGCCCGC
CTCATCTTGGCTGCCGGGTTCCGGACCAACGTCGCCCAGACCGATCTGTCCGAGATCCTTCCCGAGGAGACGGAG
GAGGCCGTCAAGAAGGCTGCCGAGATCAGCATGGGCACCGAAATCACGGAAGACGATCTCACCAACATCAAGTCG
CTGGCCGAGCAAGTGATTCTCTACACCGAGTACCGGTCACAACTCTCGTCGTATCTGGAGAGCCGGATGCGGGCC
ATTGCTCCGAACCTGACGACGCTCGTCGGCTTCCTCGTCGGTGCGAGGCTCATCGCCCATGCCGGCTCACTCATG
AACCTGGCCAAGGCCCCCGGTTCGACCATCCAGATCCTCGGTGCGGAAAAGGCCCTCTTCCGCGCCCTCAAGACG
AAGCACGACACCCCCAAGTACGGCATCATCTACCACGCTTCTCTCATCGGCCAGGCTACCGGGAGAAACAAGGGC
AAGATCGCGCGTATGCTGGCGTCGAGAACAGCGCTGGGCCTCCGCGTGGACGCCCTCGCCAACGACGACGAGGAG
GATGAGGAGCAGAGGTCGATCCTGGGCCTCACCAGCCGCATCAAGCTCGAGAACCACCTCCGCCGGCTCGAGGGA
AAGCCTCTTCTGCCCAAGGGCGCCAACGTAGCACCTTCAGGCGAGATCACAACGTCGGCCCAGTTCAGTCTGAAG
GAGACGCGGCGGTACAACGTCGACGCGGACGGCGTAGCCGATGCGGCCAACGGCGACACGCCCAAGAAGATCAAG
GGCAAGAAGTCCAAGGACGTCAAGAAGGCGTCGGCGCAGGCCGACGAAGAGATGAAGGACGCCAAGGACGACGAC
TCGGACGACTCGGCTGGTGCGGTGACAACGCCGGCCAACGGCAAGGTCGCCAAGCTGTCGAGCGACGAATACGAG
CGCCTGGCCGCCCTGGCCGGCCTGTCGGCGAAGAAGTTCAAGCGAAAGTACGAGAGGGGCGACGTGCAGCTGCAC
ACGGACGGCACGCCCAAGGTCTACAGCAAGAAGGAGCTGAAGAAGCTGCGCAAGGCGGGCGAGAACGGCACGCCG
ATCAAGCCGGAGACGCCGTCCAAGGCCGCGGCCGGGTCGGAGAAGAAGAAGCGCAAGCACGAAGACGAAGACGCG
GCCGAGGCCAAGAAGGAGAAGAAGCTGAAAAAGAAGAAGCGCCACTCGGAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail