Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6771
Gene name
LocationContig_360:14661..15696
Strand+
Gene length (bp)1035
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00312 Ribosomal_S15 Ribosomal protein S15 1.3E-19 235 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13602|RT28_SCHPO Probable 37S ribosomal protein S28, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrps28 PE=3 SV=1 57 319 1.0E-11
sp|A1WLP9|RS15_VEREI 30S ribosomal protein S15 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsO PE=3 SV=1 222 309 3.0E-10
sp|Q127W7|RS15_POLSJ 30S ribosomal protein S15 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsO PE=3 SV=1 224 309 4.0E-10
sp|C5CT25|RS15_VARPS 30S ribosomal protein S15 OS=Variovorax paradoxus (strain S110) GN=rpsO PE=3 SV=1 222 309 5.0E-10
sp|Q3YX76|RS15_SHISS 30S ribosomal protein S15 OS=Shigella sonnei (strain Ss046) GN=rpsO PE=3 SV=1 230 309 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13602|RT28_SCHPO Probable 37S ribosomal protein S28, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrps28 PE=3 SV=1 57 319 1.0E-11
sp|A1WLP9|RS15_VEREI 30S ribosomal protein S15 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsO PE=3 SV=1 222 309 3.0E-10
sp|Q127W7|RS15_POLSJ 30S ribosomal protein S15 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsO PE=3 SV=1 224 309 4.0E-10
sp|C5CT25|RS15_VARPS 30S ribosomal protein S15 OS=Variovorax paradoxus (strain S110) GN=rpsO PE=3 SV=1 222 309 5.0E-10
sp|Q3YX76|RS15_SHISS 30S ribosomal protein S15 OS=Shigella sonnei (strain Ss046) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|P0ADZ6|RS15_SHIFL 30S ribosomal protein S15 OS=Shigella flexneri GN=rpsO PE=3 SV=2 230 309 5.0E-10
sp|Q0T0B6|RS15_SHIF8 30S ribosomal protein S15 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|Q32BG8|RS15_SHIDS 30S ribosomal protein S15 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|Q31W44|RS15_SHIBS 30S ribosomal protein S15 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B2U210|RS15_SHIB3 30S ribosomal protein S15 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B7LR34|RS15_ESCF3 30S ribosomal protein S15 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|Q1R6H3|RS15_ECOUT 30S ribosomal protein S15 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B1LFR7|RS15_ECOSM 30S ribosomal protein S15 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B6I1P0|RS15_ECOSE 30S ribosomal protein S15 OS=Escherichia coli (strain SE11) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B7NDF1|RS15_ECOLU 30S ribosomal protein S15 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|P0ADZ4|RS15_ECOLI 30S ribosomal protein S15 OS=Escherichia coli (strain K12) GN=rpsO PE=1 SV=2 230 309 5.0E-10
sp|B1IQV6|RS15_ECOLC 30S ribosomal protein S15 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|P0ADZ5|RS15_ECOL6 30S ribosomal protein S15 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsO PE=3 SV=2 230 309 5.0E-10
sp|Q0TCU4|RS15_ECOL5 30S ribosomal protein S15 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|A1AG70|RS15_ECOK1 30S ribosomal protein S15 OS=Escherichia coli O1:K1 / APEC GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|A8A4Y1|RS15_ECOHS 30S ribosomal protein S15 OS=Escherichia coli O9:H4 (strain HS) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B1XGX7|RS15_ECODH 30S ribosomal protein S15 OS=Escherichia coli (strain K12 / DH10B) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|C4ZSQ6|RS15_ECOBW 30S ribosomal protein S15 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B7M073|RS15_ECO8A 30S ribosomal protein S15 OS=Escherichia coli O8 (strain IAI1) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B7N0V0|RS15_ECO81 30S ribosomal protein S15 OS=Escherichia coli O81 (strain ED1a) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B7NKN4|RS15_ECO7I 30S ribosomal protein S15 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B7LGI7|RS15_ECO55 30S ribosomal protein S15 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B7MB86|RS15_ECO45 30S ribosomal protein S15 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B7UJ60|RS15_ECO27 30S ribosomal protein S15 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|A7ZS62|RS15_ECO24 30S ribosomal protein S15 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsO PE=3 SV=1 230 309 5.0E-10
sp|B1Y822|RS15_LEPCP 30S ribosomal protein S15 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsO PE=3 SV=1 226 309 5.0E-10
sp|A8G910|RS15_SERP5 30S ribosomal protein S15 OS=Serratia proteamaculans (strain 568) GN=rpsO PE=3 SV=1 226 309 6.0E-10
sp|A6VQB6|RS15_ACTSZ 30S ribosomal protein S15 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsO PE=3 SV=1 226 309 7.0E-10
sp|B5YS55|RS15_ECO5E 30S ribosomal protein S15 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsO PE=3 SV=1 230 309 9.0E-10
sp|Q8X9M2|RS15_ECO57 30S ribosomal protein S15 OS=Escherichia coli O157:H7 GN=rpsO PE=3 SV=1 230 309 9.0E-10
sp|B0USL5|RS15_HISS2 30S ribosomal protein S15 OS=Histophilus somni (strain 2336) GN=rpsO PE=3 SV=1 226 309 1.0E-09
sp|Q0I275|RS15_HAES1 30S ribosomal protein S15 OS=Haemophilus somnus (strain 129Pt) GN=rpsO PE=3 SV=1 226 309 1.0E-09
sp|C6DKK6|RS15_PECCP 30S ribosomal protein S15 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsO PE=3 SV=1 226 309 1.0E-09
sp|A1W4L7|RS15_ACISJ 30S ribosomal protein S15 OS=Acidovorax sp. (strain JS42) GN=rpsO PE=3 SV=1 222 309 2.0E-09
sp|B9MEK9|RS15_ACIET 30S ribosomal protein S15 OS=Acidovorax ebreus (strain TPSY) GN=rpsO PE=3 SV=1 222 309 2.0E-09
sp|A9BNB9|RS15_DELAS 30S ribosomal protein S15 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsO PE=3 SV=1 222 309 2.0E-09
sp|A1TLL1|RS15_ACIAC 30S ribosomal protein S15 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsO PE=3 SV=1 222 309 2.0E-09
sp|O34274|RS15_YEREN 30S ribosomal protein S15 OS=Yersinia enterocolitica GN=rpsO PE=3 SV=3 226 309 2.0E-09
sp|A1JIX2|RS15_YERE8 30S ribosomal protein S15 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsO PE=3 SV=1 226 309 2.0E-09
sp|A4SJR8|RS15_AERS4 30S ribosomal protein S15 OS=Aeromonas salmonicida (strain A449) GN=rpsO PE=3 SV=1 223 309 3.0E-09
sp|B8F5Z2|RS15_HAEPS 30S ribosomal protein S15 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpsO PE=3 SV=1 226 309 3.0E-09
sp|B0BPU4|RS15_ACTPJ 30S ribosomal protein S15 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpsO PE=3 SV=1 226 309 3.0E-09
sp|B3H1N7|RS15_ACTP7 30S ribosomal protein S15 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpsO PE=3 SV=1 226 309 3.0E-09
sp|A3N113|RS15_ACTP2 30S ribosomal protein S15 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsO PE=3 SV=1 226 309 3.0E-09
sp|P66431|RS15_SALTY 30S ribosomal protein S15 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsO PE=3 SV=2 230 309 3.0E-09
sp|P66432|RS15_SALTI 30S ribosomal protein S15 OS=Salmonella typhi GN=rpsO PE=3 SV=2 230 309 3.0E-09
sp|B4TWD4|RS15_SALSV 30S ribosomal protein S15 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsO PE=3 SV=1 230 309 3.0E-09
sp|B5BGJ2|RS15_SALPK 30S ribosomal protein S15 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsO PE=3 SV=1 230 309 3.0E-09
sp|C0PZ51|RS15_SALPC 30S ribosomal protein S15 OS=Salmonella paratyphi C (strain RKS4594) GN=rpsO PE=3 SV=1 230 309 3.0E-09
sp|A9N729|RS15_SALPB 30S ribosomal protein S15 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsO PE=3 SV=2 230 309 3.0E-09
sp|Q5PLB3|RS15_SALPA 30S ribosomal protein S15 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsO PE=3 SV=1 230 309 3.0E-09
sp|B4T6Z5|RS15_SALNS 30S ribosomal protein S15 OS=Salmonella newport (strain SL254) GN=rpsO PE=3 SV=1 230 309 3.0E-09
sp|B4TJ03|RS15_SALHS 30S ribosomal protein S15 OS=Salmonella heidelberg (strain SL476) GN=rpsO PE=3 SV=1 230 309 3.0E-09
sp|B5REN3|RS15_SALG2 30S ribosomal protein S15 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsO PE=3 SV=1 230 309 3.0E-09
sp|B5QZV5|RS15_SALEP 30S ribosomal protein S15 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsO PE=3 SV=1 230 309 3.0E-09
sp|B5FI10|RS15_SALDC 30S ribosomal protein S15 OS=Salmonella dublin (strain CT_02021853) GN=rpsO PE=3 SV=1 230 309 3.0E-09
sp|Q57JI2|RS15_SALCH 30S ribosomal protein S15 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsO PE=3 SV=1 230 309 3.0E-09
sp|B5F6T5|RS15_SALA4 30S ribosomal protein S15 OS=Salmonella agona (strain SL483) GN=rpsO PE=3 SV=1 230 309 3.0E-09
sp|A4WEY0|RS15_ENT38 30S ribosomal protein S15 OS=Enterobacter sp. (strain 638) GN=rpsO PE=3 SV=1 226 309 3.0E-09
sp|A8AQ54|RS15_CITK8 30S ribosomal protein S15 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsO PE=3 SV=1 226 309 3.0E-09
sp|Q7VKX3|RS15_HAEDU 30S ribosomal protein S15 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsO PE=3 SV=1 226 309 4.0E-09
sp|B4F2C2|RS15_PROMH 30S ribosomal protein S15 OS=Proteus mirabilis (strain HI4320) GN=rpsO PE=3 SV=1 226 309 4.0E-09
sp|A0KNE0|RS15_AERHH 30S ribosomal protein S15 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsO PE=3 SV=1 223 309 4.0E-09
sp|Q65UQ4|RS15_MANSM 30S ribosomal protein S15 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsO PE=3 SV=1 226 309 4.0E-09
sp|B1JLX7|RS15_YERPY 30S ribosomal protein S15 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsO PE=3 SV=1 226 309 5.0E-09
sp|Q66F57|RS15_YERPS 30S ribosomal protein S15 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsO PE=3 SV=1 226 309 5.0E-09
sp|A4TRI0|RS15_YERPP 30S ribosomal protein S15 OS=Yersinia pestis (strain Pestoides F) GN=rpsO PE=3 SV=1 226 309 5.0E-09
sp|Q1CEL6|RS15_YERPN 30S ribosomal protein S15 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsO PE=3 SV=1 226 309 5.0E-09
sp|A9R5A6|RS15_YERPG 30S ribosomal protein S15 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsO PE=3 SV=1 226 309 5.0E-09
sp|Q8ZBC5|RS15_YERPE 30S ribosomal protein S15 OS=Yersinia pestis GN=rpsO PE=3 SV=1 226 309 5.0E-09
sp|B2K2Q8|RS15_YERPB 30S ribosomal protein S15 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsO PE=3 SV=1 226 309 5.0E-09
sp|Q1CC10|RS15_YERPA 30S ribosomal protein S15 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsO PE=3 SV=1 226 309 5.0E-09
sp|A7FMR9|RS15_YERP3 30S ribosomal protein S15 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsO PE=3 SV=1 226 309 5.0E-09
sp|C5BFC0|RS15_EDWI9 30S ribosomal protein S15 OS=Edwardsiella ictaluri (strain 93-146) GN=rpsO PE=3 SV=1 226 309 6.0E-09
sp|P21771|RT28_YEAST 37S ribosomal protein S28, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS28 PE=1 SV=1 239 320 1.0E-08
sp|Q6D9A2|RS15_PECAS 30S ribosomal protein S15 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsO PE=3 SV=1 226 309 1.0E-08
sp|Q9CNX1|RS15_PASMU 30S ribosomal protein S15 OS=Pasteurella multocida (strain Pm70) GN=rpsO PE=3 SV=1 230 309 1.0E-08
sp|A6TEI4|RS15_KLEP7 30S ribosomal protein S15 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsO PE=3 SV=1 226 309 1.0E-08
sp|Q0HXR2|RS15_SHESR 30S ribosomal protein S15 OS=Shewanella sp. (strain MR-7) GN=rpsO PE=3 SV=1 234 309 1.0E-08
sp|Q0HLF8|RS15_SHESM 30S ribosomal protein S15 OS=Shewanella sp. (strain MR-4) GN=rpsO PE=3 SV=1 234 309 1.0E-08
sp|A0KTZ9|RS15_SHESA 30S ribosomal protein S15 OS=Shewanella sp. (strain ANA-3) GN=rpsO PE=3 SV=1 234 309 1.0E-08
sp|A5VCY8|RS15_SPHWW 30S ribosomal protein S15 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsO PE=3 SV=1 234 309 1.0E-08
sp|B5XSX7|RS15_KLEP3 30S ribosomal protein S15 OS=Klebsiella pneumoniae (strain 342) GN=rpsO PE=3 SV=1 226 309 2.0E-08
sp|B2VGN5|RS15_ERWT9 30S ribosomal protein S15 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsO PE=3 SV=1 226 309 2.0E-08
sp|Q2G5F4|RS15_NOVAD 30S ribosomal protein S15 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsO PE=3 SV=1 219 309 3.0E-08
sp|P44389|RS15_HAEIN 30S ribosomal protein S15 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsO1 PE=3 SV=2 226 294 3.0E-08
sp|A5UEY4|RS15_HAEIG 30S ribosomal protein S15 OS=Haemophilus influenzae (strain PittGG) GN=rpsO PE=3 SV=1 226 294 3.0E-08
sp|Q8EHL3|RS15_SHEON 30S ribosomal protein S15 OS=Shewanella oneidensis (strain MR-1) GN=rpsO PE=3 SV=1 234 309 3.0E-08
sp|Q4QKJ8|RS15_HAEI8 30S ribosomal protein S15 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsO PE=3 SV=1 226 294 3.0E-08
sp|C4L8X1|RS15_TOLAT 30S ribosomal protein S15 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsO PE=3 SV=1 226 309 3.0E-08
sp|Q87EV1|RS15_XYLFT 30S ribosomal protein S15 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsO PE=3 SV=1 235 309 5.0E-08
sp|B2I729|RS15_XYLF2 30S ribosomal protein S15 OS=Xylella fastidiosa (strain M23) GN=rpsO PE=3 SV=1 235 309 5.0E-08
sp|Q142H8|RS15_BURXL 30S ribosomal protein S15 OS=Burkholderia xenovorans (strain LB400) GN=rpsO PE=3 SV=1 223 309 5.0E-08
sp|P41120|RS15_PHOLU 30S ribosomal protein S15 OS=Photorhabdus luminescens GN=rpsO PE=3 SV=3 226 309 5.0E-08
sp|A3QGU2|RS15_SHELP 30S ribosomal protein S15 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsO PE=3 SV=1 222 309 5.0E-08
sp|A1S465|RS15_SHEAM 30S ribosomal protein S15 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsO PE=3 SV=1 234 309 5.0E-08
sp|B2U7R7|RS15_RALPJ 30S ribosomal protein S15 OS=Ralstonia pickettii (strain 12J) GN=rpsO PE=3 SV=1 226 309 5.0E-08
sp|A9KZW8|RS15_SHEB9 30S ribosomal protein S15 OS=Shewanella baltica (strain OS195) GN=rpsO PE=3 SV=1 222 309 5.0E-08
sp|A3D7K3|RS15_SHEB5 30S ribosomal protein S15 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsO PE=3 SV=1 222 309 5.0E-08
sp|B8E6N5|RS15_SHEB2 30S ribosomal protein S15 OS=Shewanella baltica (strain OS223) GN=rpsO PE=3 SV=1 222 309 5.0E-08
sp|A8H737|RS15_SHEPA 30S ribosomal protein S15 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsO PE=3 SV=1 234 309 5.0E-08
sp|B0TQ99|RS15_SHEHH 30S ribosomal protein S15 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsO PE=3 SV=1 234 309 5.0E-08
sp|B8CKH6|RS15_SHEPW 30S ribosomal protein S15 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsO PE=3 SV=1 234 309 6.0E-08
sp|A5UC84|RS15_HAEIE 30S ribosomal protein S15 OS=Haemophilus influenzae (strain PittEE) GN=rpsO PE=3 SV=1 226 294 6.0E-08
sp|A1WXU8|RS15_HALHL 30S ribosomal protein S15 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsO PE=3 SV=1 226 309 7.0E-08
sp|Q0A7A0|RS15_ALKEH 30S ribosomal protein S15 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsO PE=3 SV=1 230 309 7.0E-08
sp|Q7MYY9|RS15_PHOLL 30S ribosomal protein S15 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsO PE=3 SV=1 226 309 8.0E-08
sp|B1KRQ7|RS15_SHEWM 30S ribosomal protein S15 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsO PE=3 SV=1 234 309 9.0E-08
sp|Q086G9|RS15_SHEFN 30S ribosomal protein S15 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsO PE=3 SV=1 234 309 1.0E-07
sp|A6WRG5|RS15_SHEB8 30S ribosomal protein S15 OS=Shewanella baltica (strain OS185) GN=rpsO PE=3 SV=1 234 309 1.0E-07
sp|B0U1R1|RS15_XYLFM 30S ribosomal protein S15 OS=Xylella fastidiosa (strain M12) GN=rpsO PE=3 SV=1 235 309 1.0E-07
sp|Q9PGR0|RS15_XYLFA 30S ribosomal protein S15 OS=Xylella fastidiosa (strain 9a5c) GN=rpsO PE=3 SV=1 235 309 1.0E-07
sp|Q1GVQ9|RS15_SPHAL 30S ribosomal protein S15 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsO PE=3 SV=1 219 309 1.0E-07
sp|A8FYR7|RS15_SHESH 30S ribosomal protein S15 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsO PE=3 SV=1 234 309 1.0E-07
sp|B2JDN3|RS15_BURP8 30S ribosomal protein S15 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsO PE=3 SV=1 226 309 2.0E-07
sp|B7IFB5|RS15_THEAB 30S ribosomal protein S15 OS=Thermosipho africanus (strain TCF52B) GN=rpsO PE=3 SV=1 239 309 2.0E-07
sp|Q2NW20|RS15_SODGM 30S ribosomal protein S15 OS=Sodalis glossinidius (strain morsitans) GN=rpsO PE=3 SV=1 226 309 2.0E-07
sp|Q9RXH2|RS15_DEIRA 30S ribosomal protein S15 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsO PE=3 SV=1 239 309 2.0E-07
sp|Q5GXV2|RS15_XANOR 30S ribosomal protein S15 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsO PE=3 SV=2 235 309 2.0E-07
sp|B2SVK0|RS15_XANOP 30S ribosomal protein S15 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsO PE=3 SV=1 235 309 2.0E-07
sp|Q2P0X4|RS15_XANOM 30S ribosomal protein S15 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsO PE=3 SV=1 235 309 2.0E-07
sp|Q3BRP8|RS15_XANC5 30S ribosomal protein S15 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsO PE=3 SV=1 235 309 2.0E-07
sp|Q8PJ58|RS15_XANAC 30S ribosomal protein S15 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsO PE=3 SV=1 235 309 2.0E-07
sp|A5CC63|RS15_ORITB 30S ribosomal protein S15 OS=Orientia tsutsugamushi (strain Boryong) GN=rpsO PE=3 SV=1 239 309 2.0E-07
sp|A1VM55|RS15_POLNA 30S ribosomal protein S15 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsO PE=3 SV=1 224 309 3.0E-07
sp|A4G648|RS15_HERAR 30S ribosomal protein S15 OS=Herminiimonas arsenicoxydans GN=rpsO PE=3 SV=1 230 309 3.0E-07
sp|B0UEX4|RS15_METS4 30S ribosomal protein S15 OS=Methylobacterium sp. (strain 4-46) GN=rpsO PE=3 SV=1 234 309 3.0E-07
sp|B3CTX2|RS15_ORITI 30S ribosomal protein S15 OS=Orientia tsutsugamushi (strain Ikeda) GN=rpsO PE=3 SV=1 239 309 3.0E-07
sp|Q21YD2|RS15_RHOFT 30S ribosomal protein S15 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsO PE=3 SV=1 224 309 3.0E-07
sp|Q0AE54|RS15_NITEC 30S ribosomal protein S15 OS=Nitrosomonas eutropha (strain C91) GN=rpsO PE=3 SV=1 235 309 4.0E-07
sp|Q5X1C6|RS15_LEGPA 30S ribosomal protein S15 OS=Legionella pneumophila (strain Paris) GN=rpsO PE=3 SV=1 235 309 4.0E-07
sp|A1RGX8|RS15_SHESW 30S ribosomal protein S15 OS=Shewanella sp. (strain W3-18-1) GN=rpsO PE=3 SV=1 234 309 4.0E-07
sp|A4Y9B7|RS15_SHEPC 30S ribosomal protein S15 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsO PE=3 SV=1 234 309 4.0E-07
sp|Q0VSR8|RS15_ALCBS 30S ribosomal protein S15 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsO PE=3 SV=1 234 309 4.0E-07
sp|Q8P7V0|RS15_XANCP 30S ribosomal protein S15 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsO PE=3 SV=1 235 309 4.0E-07
sp|B0RRB7|RS15_XANCB 30S ribosomal protein S15 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsO PE=3 SV=1 235 309 4.0E-07
sp|Q4UW99|RS15_XANC8 30S ribosomal protein S15 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsO PE=3 SV=1 235 309 4.0E-07
sp|B1ZS99|RS15_OPITP 30S ribosomal protein S15 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=rpsO PE=3 SV=1 225 309 4.0E-07
sp|Q12QH8|RS15_SHEDO 30S ribosomal protein S15 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsO PE=3 SV=1 234 309 4.0E-07
sp|Q1QSZ3|RS15_CHRSD 30S ribosomal protein S15 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsO PE=3 SV=1 226 309 4.0E-07
sp|Q3SKX4|RS15_THIDA 30S ribosomal protein S15 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsO PE=3 SV=1 235 309 4.0E-07
sp|A4JGD5|RS15_BURVG 30S ribosomal protein S15 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|A9AJN9|RS15_BURM1 30S ribosomal protein S15 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|Q39EE0|RS15_BURL3 30S ribosomal protein S15 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|Q0BDC5|RS15_BURCM 30S ribosomal protein S15 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|B4E5M7|RS15_BURCJ 30S ribosomal protein S15 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|A0K928|RS15_BURCH 30S ribosomal protein S15 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|B1JVP6|RS15_BURCC 30S ribosomal protein S15 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|Q1BV08|RS15_BURCA 30S ribosomal protein S15 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|B1YTR2|RS15_BURA4 30S ribosomal protein S15 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|A1ST52|RS15_PSYIN 30S ribosomal protein S15 OS=Psychromonas ingrahamii (strain 37) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|Q2SZP0|RS15_BURTA 30S ribosomal protein S15 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsO PE=3 SV=2 226 309 5.0E-07
sp|Q63VN8|RS15_BURPS 30S ribosomal protein S15 OS=Burkholderia pseudomallei (strain K96243) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|A3N7L2|RS15_BURP6 30S ribosomal protein S15 OS=Burkholderia pseudomallei (strain 668) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|Q3JUB4|RS15_BURP1 30S ribosomal protein S15 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsO PE=3 SV=2 226 309 5.0E-07
sp|A3NTA0|RS15_BURP0 30S ribosomal protein S15 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|A1V2L1|RS15_BURMS 30S ribosomal protein S15 OS=Burkholderia mallei (strain SAVP1) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|Q62IN0|RS15_BURMA 30S ribosomal protein S15 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|A2S464|RS15_BURM9 30S ribosomal protein S15 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|A3MI96|RS15_BURM7 30S ribosomal protein S15 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsO PE=3 SV=1 226 309 5.0E-07
sp|B2FN87|RS15_STRMK 30S ribosomal protein S15 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsO PE=3 SV=1 235 309 7.0E-07
sp|B4SQR7|RS15_STRM5 30S ribosomal protein S15 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsO PE=3 SV=1 235 309 7.0E-07
sp|Q8DJL5|RS15_THEEB 30S ribosomal protein S15 OS=Thermosynechococcus elongatus (strain BP-1) GN=rpsO PE=3 SV=2 237 309 8.0E-07
sp|Q2NBZ3|RS15_ERYLH 30S ribosomal protein S15 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsO PE=3 SV=1 219 309 8.0E-07
sp|Q11BC4|RS15_CHESB 30S ribosomal protein S15 OS=Chelativorans sp. (strain BNC1) GN=rpsO PE=3 SV=1 236 309 8.0E-07
sp|A5WBT1|RS15_PSYWF 30S ribosomal protein S15 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsO PE=3 SV=1 226 309 9.0E-07
sp|Q82XS9|RS15_NITEU 30S ribosomal protein S15 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsO PE=3 SV=1 235 309 9.0E-07
sp|B8IGX2|RS15_METNO 30S ribosomal protein S15 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsO PE=3 SV=1 230 309 1.0E-06
sp|Q3IYT8|RS15_RHOS4 30S ribosomal protein S15 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsO PE=3 SV=1 239 309 1.0E-06
sp|A3PNF9|RS15_RHOS1 30S ribosomal protein S15 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsO PE=3 SV=1 239 309 1.0E-06
sp|Q6MMS3|RS15_BDEBA 30S ribosomal protein S15 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsO PE=3 SV=1 239 294 1.0E-06
sp|Q1IWA0|RS15_DEIGD 30S ribosomal protein S15 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsO PE=3 SV=1 229 309 1.0E-06
sp|Q8XXP4|RS15_RALSO 30S ribosomal protein S15 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsO PE=3 SV=1 229 309 1.0E-06
sp|B3R3W1|RS15_CUPTR 30S ribosomal protein S15 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsO PE=3 SV=1 226 309 1.0E-06
sp|Q0KCT5|RS15_CUPNH 30S ribosomal protein S15 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsO PE=3 SV=1 226 309 1.0E-06
sp|A6SY01|RS15_JANMA 30S ribosomal protein S15 OS=Janthinobacterium sp. (strain Marseille) GN=rpsO PE=3 SV=1 230 309 1.0E-06
sp|Q5NZR8|RS15_AROAE 30S ribosomal protein S15 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsO PE=3 SV=1 235 309 2.0E-06
sp|Q5WT39|RS15_LEGPL 30S ribosomal protein S15 OS=Legionella pneumophila (strain Lens) GN=rpsO PE=3 SV=1 235 309 2.0E-06
sp|Q5ZRV7|RS15_LEGPH 30S ribosomal protein S15 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsO PE=3 SV=1 235 309 2.0E-06
sp|A5IHU4|RS15_LEGPC 30S ribosomal protein S15 OS=Legionella pneumophila (strain Corby) GN=rpsO PE=3 SV=1 235 309 2.0E-06
sp|A6VU32|RS15_MARMS 30S ribosomal protein S15 OS=Marinomonas sp. (strain MWYL1) GN=rpsO PE=3 SV=1 236 309 2.0E-06
sp|Q1GKK2|RS15_RUEST 30S ribosomal protein S15 OS=Ruegeria sp. (strain TM1040) GN=rpsO PE=3 SV=1 239 309 2.0E-06
sp|A6LJ39|RS15_THEM4 30S ribosomal protein S15 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsO PE=3 SV=1 239 309 2.0E-06
sp|A4WWP1|RS15_RHOS5 30S ribosomal protein S15 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsO PE=3 SV=1 239 309 2.0E-06
sp|Q473U8|RS15_CUPPJ 30S ribosomal protein S15 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsO PE=3 SV=1 226 309 2.0E-06
sp|Q2Y5X8|RS15_NITMU 30S ribosomal protein S15 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsO PE=3 SV=1 235 309 2.0E-06
sp|A1U5Z7|RS15_MARHV 30S ribosomal protein S15 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsO PE=3 SV=1 239 309 2.0E-06
sp|A6W814|RS15_KINRD 30S ribosomal protein S15 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rpsO PE=3 SV=2 220 309 2.0E-06
sp|A9IGJ8|RS15_BORPD 30S ribosomal protein S15 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsO PE=3 SV=1 226 309 2.0E-06
sp|Q5LLT1|RS15_RUEPO 30S ribosomal protein S15 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsO PE=3 SV=1 234 309 2.0E-06
sp|A1K7B6|RS15_AZOSB 30S ribosomal protein S15 OS=Azoarcus sp. (strain BH72) GN=rpsO PE=3 SV=1 223 309 3.0E-06
sp|A8Z661|RS15_SULMW 30S ribosomal protein S15 OS=Sulcia muelleri (strain GWSS) GN=rpsO PE=3 SV=1 239 293 3.0E-06
sp|A4SXQ8|RS15_POLSQ 30S ribosomal protein S15 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpsO PE=3 SV=1 230 309 3.0E-06
sp|Q7NY11|RS15_CHRVO 30S ribosomal protein S15 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsO PE=3 SV=1 235 309 4.0E-06
sp|Q0BPK2|RS15_GRABC 30S ribosomal protein S15 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsO PE=3 SV=1 226 309 4.0E-06
sp|A7IC04|RS15_XANP2 30S ribosomal protein S15 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsO PE=3 SV=1 234 309 4.0E-06
sp|B0SQH7|RS15_LEPBP 30S ribosomal protein S15 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rpsO PE=3 SV=1 226 309 4.0E-06
sp|B0SH21|RS15_LEPBA 30S ribosomal protein S15 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rpsO PE=3 SV=1 226 309 4.0E-06
sp|Q1IF40|RS15_PSEE4 30S ribosomal protein S15 OS=Pseudomonas entomophila (strain L48) GN=rpsO PE=3 SV=1 226 309 4.0E-06
sp|Q1GXD3|RS15_METFK 30S ribosomal protein S15 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpsO PE=3 SV=1 239 309 4.0E-06
sp|A7HNS0|RS15_FERNB 30S ribosomal protein S15 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsO PE=3 SV=1 239 309 5.0E-06
sp|Q7VZU1|RS15_BORPE 30S ribosomal protein S15 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsO PE=3 SV=1 226 309 5.0E-06
sp|Q7W569|RS15_BORPA 30S ribosomal protein S15 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsO PE=3 SV=1 226 309 5.0E-06
sp|Q7WCP9|RS15_BORBR 30S ribosomal protein S15 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsO PE=3 SV=1 226 309 5.0E-06
sp|Q6FF13|RS15_ACIAD 30S ribosomal protein S15 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsO PE=3 SV=1 226 309 5.0E-06
sp|Q8A418|RS15_BACTN 30S ribosomal protein S15 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsO PE=3 SV=1 234 309 5.0E-06
sp|Q88DV9|RS15_PSEPK 30S ribosomal protein S15 OS=Pseudomonas putida (strain KT2440) GN=rpsO PE=3 SV=2 226 309 5.0E-06
sp|A5W984|RS15_PSEP1 30S ribosomal protein S15 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsO PE=3 SV=1 226 309 5.0E-06
sp|Q8F7J9|RS15_LEPIN 30S ribosomal protein S15 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpsO PE=3 SV=2 226 309 5.0E-06
sp|Q72NX6|RS15_LEPIC 30S ribosomal protein S15 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpsO PE=3 SV=1 226 309 5.0E-06
sp|Q2KWI4|RS15_BORA1 30S ribosomal protein S15 OS=Bordetella avium (strain 197N) GN=rpsO PE=3 SV=1 226 309 6.0E-06
sp|Q4JV58|RS15_CORJK 30S ribosomal protein S15 OS=Corynebacterium jeikeium (strain K411) GN=rpsO PE=3 SV=1 226 309 6.0E-06
sp|B1HR10|RS15_LYSSC 30S ribosomal protein S15 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsO PE=3 SV=1 226 309 6.0E-06
sp|A9W8P9|RS15_METEP 30S ribosomal protein S15 OS=Methylobacterium extorquens (strain PA1) GN=rpsO PE=3 SV=1 234 309 7.0E-06
sp|B7KN56|RS15_METC4 30S ribosomal protein S15 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsO PE=3 SV=1 234 309 7.0E-06
sp|B6YR04|RS15_AZOPC 30S ribosomal protein S15 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpsO PE=3 SV=1 234 309 7.0E-06
sp|B1J2B2|RS15_PSEPW 30S ribosomal protein S15 OS=Pseudomonas putida (strain W619) GN=rpsO PE=3 SV=1 235 309 7.0E-06
sp|B0KHX5|RS15_PSEPG 30S ribosomal protein S15 OS=Pseudomonas putida (strain GB-1) GN=rpsO PE=3 SV=1 235 309 7.0E-06
sp|B1ZGS8|RS15_METPB 30S ribosomal protein S15 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsO PE=3 SV=1 230 309 7.0E-06
sp|B5Y8I3|RS15_COPPD 30S ribosomal protein S15 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rpsO PE=3 SV=1 239 309 8.0E-06
sp|C0QHM5|RS15_DESAH 30S ribosomal protein S15 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rpsO PE=3 SV=1 238 309 9.0E-06
sp|A1AVW6|RS15_RUTMC 30S ribosomal protein S15 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpsO PE=3 SV=1 239 309 1.0E-05
sp|Q18BI0|RS15_PEPD6 30S ribosomal protein S15 OS=Peptoclostridium difficile (strain 630) GN=rpsO PE=3 SV=1 226 309 1.0E-05
sp|C4K3E7|RS15_HAMD5 30S ribosomal protein S15 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpsO PE=3 SV=1 226 309 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005622 intracellular Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044267 cellular protein metabolic process No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6771
MAPRLEVLQRLGTIKLCLRPPARPVPPLSLLPVVQRAGLSQREKKRLANKDPYRWAQAQQRKNANLKRRAQLEKE
RSEALGDPVLGNTTPFLESLDWAGQEEMSRVKTDGDGNPIGGAEPHKLPTSPGLRSYGLTDAELDDAAKHAFVMT
KPLTSSIRAGLDVDGDEEMQQHERTHKKALLALRRITSLDLGGATDRFHANVRRIVDEFGRHKTDKFLEPKPPSI
RPNTVPMPGRAGPDTGSSEVQIAILTAKIRALHLASKVNRGYKDRQGPRKLRLLVHRRQKLLKYMERKERGSGRW
THMLEKLGLTPAAWKGEITV*
Coding >Hirsu2|6771
ATGGCGCCCAGATTAGAGGTGCTGCAGCGCCTAGGAACCATCAAGCTCTGCCTCCGGCCTCCGGCTCGACCTGTC
CCGCCGCTGAGTCTCCTGCCCGTTGTGCAGAGGGCCGGTCTGTCGCAGCGGGAGAAGAAGCGGCTGGCCAACAAG
GATCCCTACCGGTGGGCGCAGGCGCAGCAGCGTAAAAACGCCAACCTCAAGCGCCGGGCCCAGCTCGAGAAGGAA
CGCAGCGAGGCCCTTGGCGACCCCGTGCTGGGCAACACGACGCCCTTCCTCGAGTCACTCGACTGGGCCGGGCAG
GAGGAGATGTCGAGGGTCAAGACGGATGGCGACGGAAACCCCATCGGCGGGGCGGAGCCGCACAAGCTGCCCACG
TCCCCCGGTCTGCGCAGCTACGGTCTCACCGACGCCGAGCTGGACGACGCGGCCAAGCACGCCTTCGTCATGACC
AAGCCCCTGACCAGCTCGATCCGGGCCGGCCTCGACGTGGACGGGGACGAGGAGATGCAGCAGCACGAGAGGACG
CACAAGAAGGCGCTCCTCGCCCTGCGCCGCATCACGTCCCTCGACCTCGGCGGCGCCACCGATCGTTTCCACGCA
AATGTGAGGCGCATCGTCGACGAGTTCGGCCGGCACAAGACGGACAAGTTCCTCGAGCCCAAGCCGCCGTCGATA
CGTCCGAATACGGTGCCGATGCCCGGACGCGCCGGGCCGGATACCGGCAGCTCCGAGGTGCAGATCGCCATTCTC
ACCGCCAAGATCAGGGCGCTGCACCTGGCCTCCAAGGTCAACCGGGGCTACAAGGACAGGCAGGGCCCGAGGAAA
CTCAGACTACTCGTGCATCGGCGCCAGAAGTTGCTCAAGTACATGGAGAGGAAAGAGAGAGGAAGCGGGAGGTGG
ACACACATGCTCGAGAAGCTGGGCCTCACGCCCGCCGCTTGGAAGGGAGAAATCACGGTCTAG
Transcript >Hirsu2|6771
ATGGCGCCCAGATTAGAGGTGCTGCAGCGCCTAGGAACCATCAAGCTCTGCCTCCGGCCTCCGGCTCGACCTGTC
CCGCCGCTGAGTCTCCTGCCCGTTGTGCAGAGGGCCGGTCTGTCGCAGCGGGAGAAGAAGCGGCTGGCCAACAAG
GATCCCTACCGGTGGGCGCAGGCGCAGCAGCGTAAAAACGCCAACCTCAAGCGCCGGGCCCAGCTCGAGAAGGAA
CGCAGCGAGGCCCTTGGCGACCCCGTGCTGGGCAACACGACGCCCTTCCTCGAGTCACTCGACTGGGCCGGGCAG
GAGGAGATGTCGAGGGTCAAGACGGATGGCGACGGAAACCCCATCGGCGGGGCGGAGCCGCACAAGCTGCCCACG
TCCCCCGGTCTGCGCAGCTACGGTCTCACCGACGCCGAGCTGGACGACGCGGCCAAGCACGCCTTCGTCATGACC
AAGCCCCTGACCAGCTCGATCCGGGCCGGCCTCGACGTGGACGGGGACGAGGAGATGCAGCAGCACGAGAGGACG
CACAAGAAGGCGCTCCTCGCCCTGCGCCGCATCACGTCCCTCGACCTCGGCGGCGCCACCGATCGTTTCCACGCA
AATGTGAGGCGCATCGTCGACGAGTTCGGCCGGCACAAGACGGACAAGTTCCTCGAGCCCAAGCCGCCGTCGATA
CGTCCGAATACGGTGCCGATGCCCGGACGCGCCGGGCCGGATACCGGCAGCTCCGAGGTGCAGATCGCCATTCTC
ACCGCCAAGATCAGGGCGCTGCACCTGGCCTCCAAGGTCAACCGGGGCTACAAGGACAGGCAGGGCCCGAGGAAA
CTCAGACTACTCGTGCATCGGCGCCAGAAGTTGCTCAAGTACATGGAGAGGAAAGAGAGAGGAAGCGGGAGGTGG
ACACACATGCTCGAGAAGCTGGGCCTCACGCCCGCCGCTTGGAAGGGAGAAATCACGGTCTAG
Gene >Hirsu2|6771
ATGGCGCCCAGATTAGAGGTGCTGCAGCGCCTAGGAACCATCAAGCGTAGGGGGGGAAGAGACCCATCCCCCACA
CGCCTCGGCAATGTCGAGCGGCCTCGTCGCTGACAATCTCCAGTCTGCCTCCGGCCTCCGGCTCGACCTGTCCCG
CCGCTGAGTCTCCTGCCCGTTGTGCAGAGGGCCGGTCTGTCGCAGCGGGAGAAGAAGCGGCTGGCCAACAAGGAT
CCCTACCGGTGGGCGCAGGCGCAGCAGCGTAAAAACGCCAACCTCAAGCGCCGGGCCCAGCTCGAGAAGGAACGC
AGCGAGGCCCTTGGCGACCCCGTGCTGGGCAACACGACGCCCTTCCTCGAGTCACTCGACTGGGCCGGGCAGGAG
GAGATGTCGAGGGTCAAGACGGATGGCGACGGAAACCCCATCGGCGGGGCGGAGCCGCACAAGCTGCCCACGTCC
CCCGGTCTGCGCAGCTACGGTCTCACCGACGCCGAGCTGGACGACGCGGCCAAGCACGCCTTCGTCATGACCAAG
CCCCTGACCAGCTCGATCCGGGCCGGCCTCGACGTGGACGGGGACGAGGAGATGCAGCAGCACGAGAGGACGCAC
AAGAAGGCGCTCCTCGCCCTGCGCCGCATCACGTCCCTCGACCTCGGCGGCGCCACCGATCGTTTCCACGCAAAT
GTGAGGCGCATCGTCGACGAGTTCGGCCGGCACAAGACGGACAAGTTCCTCGAGCCCAAGCCGCCGTCGATACGT
CCGAATACGGTGCCGATGCCCGGACGCGCCGGGCCGGATACCGGCAGCTCCGAGGTGCAGATCGCCATTCTCACC
GCCAAGATCAGGGCGCTGCACCTGGCCTCCAAGGTCAACCGGGGCTACAAGGACAGGCAGGGCCCGAGGAAACTC
AGACTACTCGTGCATCGGCGCCAGAAGTTGCTCAAGTACATGGAGAGGAAAGAGAGAGGAAGCGGGAGGTGGACA
CACATGCTCGAGAAGCTGGGCCTCACGCCCGCCGCTTGGAAGGGAGAAATCACGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail