Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6757
Gene name
LocationContig_36:25751..26466
Strand+
Gene length (bp)715
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00668 Condensation Condensation domain 9.3E-18 3 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2 191 3.0E-34
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2 191 8.0E-34
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2 191 1.0E-33
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2 191 1.0E-29
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 174 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2 191 3.0E-34
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2 191 8.0E-34
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2 191 1.0E-33
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2 191 1.0E-29
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 174 2.0E-26
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1 177 3.0E-25
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1 188 1.0E-21
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2 184 1.0E-20
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1 191 7.0E-16
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 6 106 1.0E-11
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 191 7.0E-11
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1 191 1.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 9 171 2.0E-10
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 188 3.0E-10
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2 47 1.0E-09
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1 190 1.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1 191 2.0E-09
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1 191 3.0E-09
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1 103 5.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 191 8.0E-09
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 6 191 8.0E-09
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2 191 2.0E-08
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2 191 5.0E-08
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1 191 5.0E-08
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1 191 8.0E-08
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1 86 1.0E-07
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 4 123 2.0E-07
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2 104 2.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 182 2.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1 191 3.0E-07
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1 102 3.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 81 6.0E-07
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1 177 6.0E-07
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3 70 7.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1 172 1.0E-06
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1 191 2.0E-06
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 6 190 2.0E-06
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1 170 3.0E-06
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 5 190 4.0E-06
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1 84 6.0E-06
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 6 191 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6757
MIQLSWAVTLSHYTDSQDVVFGLTSNGRAAPLDEIAEVTGPTIATVPVRVSLGSDKTISASLSEMQQQTIAMIPF
LHHGLHRIRKLGADAAWACDFQTHLVIQPPDVTRLDLGNLAMQEEEDMKGYESFSSYALVVIFNMLSGSNGLDVW
VNYDSNVLEEAEARRMLEQFGAVLRQVHDRPQFEIRDIDIII*
Coding >Hirsu2|6757
ATGATCCAGCTATCCTGGGCCGTCACGCTGTCGCACTACACAGACTCTCAAGATGTCGTGTTTGGACTTACCTCG
AATGGTAGAGCCGCTCCTCTGGACGAAATTGCCGAAGTTACGGGTCCGACCATTGCGACAGTTCCCGTGCGTGTT
TCCCTGGGCTCGGACAAGACAATCAGCGCCTCGCTGTCCGAGATGCAGCAGCAGACAATCGCCATGATTCCGTTT
CTGCACCACGGGCTGCACAGGATCCGAAAGCTCGGCGCAGACGCTGCCTGGGCCTGCGACTTCCAGACGCACCTG
GTTATCCAACCACCCGACGTGACCAGGCTGGACCTGGGAAATCTTGCAATGCAAGAAGAAGAGGATATGAAGGGC
TATGAGAGTTTTTCGAGCTATGCTCTCGTCGTCATCTTTAACATGCTGTCGGGATCGAACGGCCTCGATGTATGG
GTTAACTACGACTCCAACGTACTGGAAGAAGCCGAGGCTCGGAGAATGTTGGAGCAGTTCGGCGCCGTTTTGCGC
CAGGTTCACGACAGGCCACAATTCGAGATCCGAGACATCGACATTATCATATAA
Transcript >Hirsu2|6757
ATGATCCAGCTATCCTGGGCCGTCACGCTGTCGCACTACACAGACTCTCAAGATGTCGTGTTTGGACTTACCTCG
AATGGTAGAGCCGCTCCTCTGGACGAAATTGCCGAAGTTACGGGTCCGACCATTGCGACAGTTCCCGTGCGTGTT
TCCCTGGGCTCGGACAAGACAATCAGCGCCTCGCTGTCCGAGATGCAGCAGCAGACAATCGCCATGATTCCGTTT
CTGCACCACGGGCTGCACAGGATCCGAAAGCTCGGCGCAGACGCTGCCTGGGCCTGCGACTTCCAGACGCACCTG
GTTATCCAACCACCCGACGTGACCAGGCTGGACCTGGGAAATCTTGCAATGCAAGAAGAAGAGGATATGAAGGGC
TATGAGAGTTTTTCGAGCTATGCTCTCGTCGTCATCTTTAACATGCTGTCGGGATCGAACGGCCTCGATGTATGG
GTTAACTACGACTCCAACGTACTGGAAGAAGCCGAGGCTCGGAGAATGTTGGAGCAGTTCGGCGCCGTTTTGCGC
CAGGTTCACGACAGGCCACAATTCGAGATCCGAGACATCGACATTATCATATAA
Gene >Hirsu2|6757
ATGATCCAGCTATCCTGGGCCGTCACGCTGTCGCACTACACAGACTCTCAAGATGTCGTGTTTGGACTTACCTCG
AATGGTAGAGCCGCTCCTCTGGACGAAATTGCCGAAGTTACGGGTCCGACCATTGCGACAGTTCCCGTGCGTGTT
TCCCTGGGCTCGGACAAGACAATCAGCGCCTCGCTGTCCGAGATGCAGCAGCAGACAATCGCCATGATTCCGTTT
CTGCACCACGGGCTGCACAGGATCCGAAAGCTCGGCGCAGACGCTGCCTGGGCCTGCGACTTCCAGACGCACCTG
GTTATCCAACCACCCGACGTGACCAGGCTGGACCTGGGAAATCTTGCAATGCAAGAAGAAGAGGATATGAAGGGC
TATGAGAGTTTTTCGAGCTATGCTCTCGTCGTCATCTTTAACATGCTGTCGGGATCGAACGGCCTCGATGTATGG
GTTAACTACGACTCCAACGTACTGGAAGAAGCCGAGGCTCGGAGAATGTTGGAGCAGTTCGGCGCCGTTTTGCGC
CAGGTTCACGACAGGCCACAATTCGAGATCCGAGACATCGACATTATCAGTAAGCAAGATATGAAGCAGTTGTCC
GCTTGGAATAGCCATGTCCCGCCTGCACAGCACCAGACGTTACATGATCTAGTCTTGCGCCACGGCTTGACTCAG
CCGGAAGCTGAAGCAGTGTTTGCCAGGGACGGCAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail