Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|675
Gene name
LocationContig_1136:1958..4992
Strand+
Gene length (bp)3034
Transcript length (bp)2955
Coding sequence length (bp)2955
Protein length (aa) 985

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08619 Nha1_C Alkali metal cation/H+ antiporter Nha1 C terminus 6.1E-127 458 959
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 5.9E-76 16 434

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14123|NAH2_SCHPO Probable Na(+)/H(+) antiporter C3A11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod22 PE=1 SV=1 1 449 0.0E+00
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 3 471 0.0E+00
sp|O42701|NAH2_ZYGRO Na(+)/H(+) antiporter 2 OS=Zygosaccharomyces rouxii GN=SOD22 PE=3 SV=1 1 713 0.0E+00
sp|Q99173|NAH1_ZYGRO Na(+)/H(+) antiporter 1 OS=Zygosaccharomyces rouxii GN=SOD2 PE=3 SV=1 1 713 0.0E+00
sp|P36606|NAH_SCHPO Na(+)/H(+) antiporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod2 PE=1 SV=1 1 454 3.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14123|NAH2_SCHPO Probable Na(+)/H(+) antiporter C3A11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod22 PE=1 SV=1 1 449 0.0E+00
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 3 471 0.0E+00
sp|O42701|NAH2_ZYGRO Na(+)/H(+) antiporter 2 OS=Zygosaccharomyces rouxii GN=SOD22 PE=3 SV=1 1 713 0.0E+00
sp|Q99173|NAH1_ZYGRO Na(+)/H(+) antiporter 1 OS=Zygosaccharomyces rouxii GN=SOD2 PE=3 SV=1 1 713 0.0E+00
sp|P36606|NAH_SCHPO Na(+)/H(+) antiporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod2 PE=1 SV=1 1 454 3.0E-120
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 609 743 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015385 sodium:proton antiporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0006812 cation transport Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0006814 sodium ion transport Yes
GO:0015491 cation:cation antiporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015298 solute:cation antiporter activity No
GO:0046873 metal ion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0022804 active transmembrane transporter activity No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0099516 ion antiporter activity No
GO:0015672 monovalent inorganic cation transport No
GO:0015078 proton transmembrane transporter activity No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005451 monovalent cation:proton antiporter activity No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0015291 secondary active transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0005215 transporter activity No
GO:0015081 sodium ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0030001 metal ion transport No
GO:0003674 molecular_function No
GO:0015297 antiporter activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 102 124 22
3 134 153 19
4 174 193 19
5 203 225 22
6 246 265 19
7 293 315 22
8 327 349 22
9 364 386 22
10 407 429 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|675
MAWSHLDITKPHLVYIILGGFTSLFMLCSSFIKERMYIGEATVATLCGVIFGPHAANLINPNEWGSTDIVTLEFS
RIVLVVQCFAVGVELPKFYMEKHWRSVVFLLVPVMMFGWLIVSLFIWWMVPPLDWLESLVVAACVTATDPVLASS
VVGKGKFAKRVPKHLRDLLSAESGCNDGMAFPFIYLSLYLIQFNRNAGEVTYYFVVYVILYECIFGAVYGFIVGY
IARHGIKFAEQHDLIDRESFLVFYFVVALFCAGSGSILGLDDLLVGFSAGVGFSNDGWFGEKTEESHVSNVIDLL
LNLTYFVYFGTIIPWEQYNNNVFGLQAWRLVVIAIFVLLFRRIPIMMALKPLIPDVKNWREALFAGHFGPIGVGA
IFVAILARAELEHEEPVPLAEMPPPDSENYELIYLVWPIVTFLVISSILIHGSSVAVFTLGKRINTLTLTMSYTA
APDDGPSWMNRLPRISSQSRSQAKTMSDASFDDPKEPEFPAGTLAPPSGFLRRQRDEDNPSRTGSRASSLVSKKR
KSKKWDDGIGPGGPVSQSAIFPSRPPLLSGNSEKEPSPPARENTDSTTLSESSPKEKDTERSGPESSDSPRTQQG
SRTPRVELYEEGDQIVIENEDGDVLDVQPTPNPLEQELAPPSRRPRPGPSSEPFNWSFGGLRRKMSEVYSSEMEK
RKDKGKSHRRHEPARAYQFGNMIIVEDEDGEVVKTYELPSQRSESQEGGDLLVSSLKYLGLGARSRPGEKSSEAA
AAEEGRAGETTPGKQPARSGWGGFGRGGAEQARKKSFALQQEADDDKKIRFTIGGVGQRMTKEDFIREVQKLDVR
TRKEVVDHSTASSAVKKLAQQGPPSRSTATPSVPVIREHSSDNSKAGSGYFGPQQSGSLSPVPPPTGSSGLSPTS
RDRPSEIQGETPVERRRRLAVLAGQAEEGEDTGETPAERRRRQAALGVTGTEIAEESDSEDEGTERVPPARRGIR
FAEPQRSGK*
Coding >Hirsu2|675
ATGGCCTGGTCTCATCTCGACATCACCAAGCCGCACTTGGTCTACATCATCCTCGGCGGCTTCACTTCCCTCTTC
ATGCTCTGCTCCTCCTTCATCAAGGAGCGCATGTACATCGGCGAAGCCACCGTGGCCACCCTCTGCGGCGTCATC
TTCGGGCCCCATGCCGCCAACCTCATCAACCCCAACGAATGGGGCAGCACCGACATCGTCACCCTCGAGTTCTCC
CGCATCGTCCTCGTCGTCCAGTGCTTCGCCGTCGGCGTCGAGCTGCCCAAGTTCTACATGGAGAAGCACTGGCGT
TCCGTCGTCTTCCTCCTCGTCCCGGTCATGATGTTCGGCTGGCTCATCGTCAGCCTCTTCATCTGGTGGATGGTC
CCGCCCCTCGACTGGCTCGAGTCCCTCGTCGTCGCCGCCTGCGTCACCGCCACCGACCCCGTCCTCGCCTCCTCC
GTCGTCGGCAAGGGTAAGTTCGCCAAGCGCGTCCCCAAGCACTTGCGCGACCTGCTGTCCGCCGAGTCGGGCTGC
AACGACGGCATGGCCTTCCCCTTCATCTACCTCTCGCTCTACCTCATCCAGTTCAACCGCAACGCCGGCGAGGTC
ACCTACTACTTCGTCGTCTACGTCATCCTCTACGAATGCATCTTCGGCGCCGTCTACGGCTTCATCGTCGGCTAC
ATCGCCCGCCACGGCATCAAGTTCGCCGAGCAGCACGACCTCATCGATCGCGAGAGCTTCCTCGTCTTCTACTTC
GTCGTCGCCCTCTTCTGCGCCGGCTCCGGCAGCATCCTCGGCCTCGACGACCTGCTCGTCGGCTTCTCCGCCGGC
GTCGGCTTCTCCAACGACGGCTGGTTCGGCGAGAAGACGGAGGAGTCCCACGTGTCCAACGTCATCGACCTGCTC
CTCAACTTGACCTACTTCGTCTACTTCGGCACCATCATCCCCTGGGAGCAGTACAATAACAATGTCTTCGGCCTC
CAGGCCTGGCGCCTCGTCGTCATCGCCATCTTCGTCCTGCTCTTCCGCCGCATACCCATCATGATGGCCCTCAAG
CCTCTCATACCGGATGTCAAGAACTGGAGAGAGGCCCTGTTCGCCGGCCACTTCGGCCCCATTGGCGTCGGCGCC
ATCTTCGTCGCCATCCTCGCCAGGGCCGAGCTGGAGCACGAGGAGCCCGTGCCGCTGGCCGAGATGCCGCCACCG
GACTCGGAGAACTACGAGCTGATTTACCTCGTATGGCCCATCGTCACCTTTCTCGTTATCTCGTCCATCCTCATA
CACGGCTCTTCTGTCGCCGTCTTCACCCTCGGCAAGCGCATCAACACGTTGACCTTGACCATGTCGTACACGGCC
GCTCCCGACGACGGGCCCTCGTGGATGAACAGGCTGCCCCGCATCTCGTCCCAGTCCCGATCGCAGGCCAAGACT
ATGTCGGACGCCTCCTTCGACGACCCCAAGGAACCCGAGTTCCCGGCCGGCACGCTGGCGCCCCCCTCCGGCTTC
CTGCGTCGCCAGAGAGATGAGGACAACCCGAGCCGGACCGGGAGCCGGGCCTCGTCCCTGGTGTCCAAAAAGCGG
AAGAGCAAGAAGTGGGACGACGGCATAGGCCCCGGCGGCCCCGTGAGCCAGTCCGCCATCTTTCCCAGCCGGCCG
CCGCTCCTGAGCGGCAACTCGGAGAAGGAGCCGTCTCCGCCCGCCCGCGAGAACACCGACTCGACCACGCTGTCA
GAGAGCAGCCCGAAAGAGAAGGATACGGAAAGATCGGGCCCCGAGAGCAGCGACAGCCCGCGGACACAGCAGGGC
TCCCGAACCCCTCGAGTCGAGTTGTACGAGGAAGGCGATCAGATCGTCATCGAGAACGAGGACGGAGACGTGCTG
GATGTCCAGCCGACCCCCAATCCGCTCGAGCAAGAACTCGCGCCTCCCAGCAGGCGGCCTCGACCGGGCCCCAGC
AGCGAGCCCTTCAACTGGTCCTTTGGCGGTCTTCGGCGGAAGATGAGCGAGGTCTACAGCTCGGAGATGGAGAAG
CGTAAGGATAAGGGGAAGAGCCACCGACGTCACGAGCCGGCGCGGGCCTATCAGTTCGGCAACATGATCATCGTC
GAGGACGAGGACGGAGAAGTCGTCAAGACGTACGAACTGCCCTCGCAGAGGAGCGAAAGCCAGGAGGGCGGCGAC
CTGCTCGTCTCCAGCTTGAAGTATCTCGGCCTCGGCGCCCGGTCACGTCCGGGCGAGAAGAGCAGCGAAGCCGCC
GCGGCCGAGGAGGGCCGGGCGGGAGAAACGACCCCGGGCAAGCAGCCGGCCAGGTCGGGATGGGGCGGCTTCGGT
AGGGGCGGCGCGGAGCAGGCCCGGAAGAAGAGCTTCGCGCTGCAGCAAGAGGCGGACGACGACAAGAAGATTCGT
TTCACAATCGGGGGGGTTGGCCAGCGCATGACGAAGGAGGACTTCATCAGGGAGGTCCAGAAACTGGATGTCAGG
ACGCGCAAAGAGGTTGTGGACCACTCGACGGCGTCGTCGGCCGTCAAGAAACTCGCGCAGCAGGGCCCGCCGTCC
CGGTCGACGGCCACGCCGTCCGTGCCGGTGATCCGGGAGCACAGCAGCGACAACAGCAAGGCGGGGAGCGGCTAC
TTCGGACCGCAACAGTCCGGGTCCCTCTCGCCGGTGCCGCCGCCGACGGGCTCGTCGGGCCTGTCGCCGACGTCG
CGTGACCGGCCGTCGGAGATACAGGGCGAGACGCCCGTGGAACGCAGGCGGCGGCTGGCCGTGCTGGCGGGCCAG
GCCGAGGAGGGCGAGGACACGGGCGAAACGCCGGCGGAGCGGCGGCGGCGGCAGGCCGCGCTGGGCGTGACGGGC
ACGGAGATCGCCGAGGAGAGCGACAGCGAGGACGAGGGCACGGAGCGGGTGCCGCCAGCTCGGAGAGGTATTAGG
TTCGCCGAGCCGCAGCGGAGTGGGAAGTAG
Transcript >Hirsu2|675
ATGGCCTGGTCTCATCTCGACATCACCAAGCCGCACTTGGTCTACATCATCCTCGGCGGCTTCACTTCCCTCTTC
ATGCTCTGCTCCTCCTTCATCAAGGAGCGCATGTACATCGGCGAAGCCACCGTGGCCACCCTCTGCGGCGTCATC
TTCGGGCCCCATGCCGCCAACCTCATCAACCCCAACGAATGGGGCAGCACCGACATCGTCACCCTCGAGTTCTCC
CGCATCGTCCTCGTCGTCCAGTGCTTCGCCGTCGGCGTCGAGCTGCCCAAGTTCTACATGGAGAAGCACTGGCGT
TCCGTCGTCTTCCTCCTCGTCCCGGTCATGATGTTCGGCTGGCTCATCGTCAGCCTCTTCATCTGGTGGATGGTC
CCGCCCCTCGACTGGCTCGAGTCCCTCGTCGTCGCCGCCTGCGTCACCGCCACCGACCCCGTCCTCGCCTCCTCC
GTCGTCGGCAAGGGTAAGTTCGCCAAGCGCGTCCCCAAGCACTTGCGCGACCTGCTGTCCGCCGAGTCGGGCTGC
AACGACGGCATGGCCTTCCCCTTCATCTACCTCTCGCTCTACCTCATCCAGTTCAACCGCAACGCCGGCGAGGTC
ACCTACTACTTCGTCGTCTACGTCATCCTCTACGAATGCATCTTCGGCGCCGTCTACGGCTTCATCGTCGGCTAC
ATCGCCCGCCACGGCATCAAGTTCGCCGAGCAGCACGACCTCATCGATCGCGAGAGCTTCCTCGTCTTCTACTTC
GTCGTCGCCCTCTTCTGCGCCGGCTCCGGCAGCATCCTCGGCCTCGACGACCTGCTCGTCGGCTTCTCCGCCGGC
GTCGGCTTCTCCAACGACGGCTGGTTCGGCGAGAAGACGGAGGAGTCCCACGTGTCCAACGTCATCGACCTGCTC
CTCAACTTGACCTACTTCGTCTACTTCGGCACCATCATCCCCTGGGAGCAGTACAATAACAATGTCTTCGGCCTC
CAGGCCTGGCGCCTCGTCGTCATCGCCATCTTCGTCCTGCTCTTCCGCCGCATACCCATCATGATGGCCCTCAAG
CCTCTCATACCGGATGTCAAGAACTGGAGAGAGGCCCTGTTCGCCGGCCACTTCGGCCCCATTGGCGTCGGCGCC
ATCTTCGTCGCCATCCTCGCCAGGGCCGAGCTGGAGCACGAGGAGCCCGTGCCGCTGGCCGAGATGCCGCCACCG
GACTCGGAGAACTACGAGCTGATTTACCTCGTATGGCCCATCGTCACCTTTCTCGTTATCTCGTCCATCCTCATA
CACGGCTCTTCTGTCGCCGTCTTCACCCTCGGCAAGCGCATCAACACGTTGACCTTGACCATGTCGTACACGGCC
GCTCCCGACGACGGGCCCTCGTGGATGAACAGGCTGCCCCGCATCTCGTCCCAGTCCCGATCGCAGGCCAAGACT
ATGTCGGACGCCTCCTTCGACGACCCCAAGGAACCCGAGTTCCCGGCCGGCACGCTGGCGCCCCCCTCCGGCTTC
CTGCGTCGCCAGAGAGATGAGGACAACCCGAGCCGGACCGGGAGCCGGGCCTCGTCCCTGGTGTCCAAAAAGCGG
AAGAGCAAGAAGTGGGACGACGGCATAGGCCCCGGCGGCCCCGTGAGCCAGTCCGCCATCTTTCCCAGCCGGCCG
CCGCTCCTGAGCGGCAACTCGGAGAAGGAGCCGTCTCCGCCCGCCCGCGAGAACACCGACTCGACCACGCTGTCA
GAGAGCAGCCCGAAAGAGAAGGATACGGAAAGATCGGGCCCCGAGAGCAGCGACAGCCCGCGGACACAGCAGGGC
TCCCGAACCCCTCGAGTCGAGTTGTACGAGGAAGGCGATCAGATCGTCATCGAGAACGAGGACGGAGACGTGCTG
GATGTCCAGCCGACCCCCAATCCGCTCGAGCAAGAACTCGCGCCTCCCAGCAGGCGGCCTCGACCGGGCCCCAGC
AGCGAGCCCTTCAACTGGTCCTTTGGCGGTCTTCGGCGGAAGATGAGCGAGGTCTACAGCTCGGAGATGGAGAAG
CGTAAGGATAAGGGGAAGAGCCACCGACGTCACGAGCCGGCGCGGGCCTATCAGTTCGGCAACATGATCATCGTC
GAGGACGAGGACGGAGAAGTCGTCAAGACGTACGAACTGCCCTCGCAGAGGAGCGAAAGCCAGGAGGGCGGCGAC
CTGCTCGTCTCCAGCTTGAAGTATCTCGGCCTCGGCGCCCGGTCACGTCCGGGCGAGAAGAGCAGCGAAGCCGCC
GCGGCCGAGGAGGGCCGGGCGGGAGAAACGACCCCGGGCAAGCAGCCGGCCAGGTCGGGATGGGGCGGCTTCGGT
AGGGGCGGCGCGGAGCAGGCCCGGAAGAAGAGCTTCGCGCTGCAGCAAGAGGCGGACGACGACAAGAAGATTCGT
TTCACAATCGGGGGGGTTGGCCAGCGCATGACGAAGGAGGACTTCATCAGGGAGGTCCAGAAACTGGATGTCAGG
ACGCGCAAAGAGGTTGTGGACCACTCGACGGCGTCGTCGGCCGTCAAGAAACTCGCGCAGCAGGGCCCGCCGTCC
CGGTCGACGGCCACGCCGTCCGTGCCGGTGATCCGGGAGCACAGCAGCGACAACAGCAAGGCGGGGAGCGGCTAC
TTCGGACCGCAACAGTCCGGGTCCCTCTCGCCGGTGCCGCCGCCGACGGGCTCGTCGGGCCTGTCGCCGACGTCG
CGTGACCGGCCGTCGGAGATACAGGGCGAGACGCCCGTGGAACGCAGGCGGCGGCTGGCCGTGCTGGCGGGCCAG
GCCGAGGAGGGCGAGGACACGGGCGAAACGCCGGCGGAGCGGCGGCGGCGGCAGGCCGCGCTGGGCGTGACGGGC
ACGGAGATCGCCGAGGAGAGCGACAGCGAGGACGAGGGCACGGAGCGGGTGCCGCCAGCTCGGAGAGGTATTAGG
TTCGCCGAGCCGCAGCGGAGTGGGAAGTAG
Gene >Hirsu2|675
ATGGCCTGGTCTCATCTCGACATCACCAAGCCGCACTTGGTCTACATCATCCTCGGCGGCTTCACTTCCCTCTTC
ATGCTCTGCTCCTCCTTCATCAAGGAGCGCATGTACATCGGCGAAGCCACCGTGGCCACCCTCTGCGGCGTCATC
TTCGGGCCCCATGCCGCCAACCTCATCAACCCCAACGAATGGGGCAGCACCGACATCGTCACCCTCGAGTTCTCC
CGCATCGTCCTCGTCGTCCAGTGCTTCGCCGTCGGCGTCGAGCTGCCCAAGTTCTACATGGAGAAGCACTGGCGT
TCCGTCGTCTTCCTCCTCGTCCCGGTCATGATGTTCGGCTGGCTCATCGTCAGCCTCTTCATCTGGTGGATGGTC
CCGCCCCTCGACTGGCTCGAGTCCCTCGTCGTCGCCGCCTGCGTCACCGCCACCGACCCCGTCCTCGCCTCCTCC
GTCGTCGGCAAGGGTAAGTTCGCCAAGCGCGTCCCCAAGCACTTGCGCGACCTGCTGTCCGCCGAGTCGGGCTGC
AACGACGGCATGGCCTTCCCCTTCATCTACCTCTCGCTCTACCTCATCCAGTTCAACCGCAACGCCGGCGAGGTC
ACCTACTACTTCGTCGTCTACGTCATCCTCTACGAATGCATCTTCGGCGCCGTCTACGGCTTCATCGTCGGCTAC
ATCGCCCGCCACGGCATCAAGTTCGCCGAGCAGCACGACCTCATCGATCGCGAGAGCTTCCTCGTCTTCTACTTC
GTCGTCGCCCTCTTCTGCGCCGGCTCCGGCAGCATCCTCGGCCTCGACGACCTGCTCGTCGGCTTCTCCGCCGGC
GTCGGCTTCTCCAACGACGGCTGGTTCGGCGAGAAGACGGAGGAGTCCCACGTGTCCAACGTCATCGACCTGCTC
CTCAACTTGACCTACTTCGTCTACTTCGGCACCATCATCCCCTGGGAGCAGTACAATAACAATGTCTTCGGCCTC
CAGGCCTGGCGCCTCGTCGTCATCGCCATCTTCGTCCTGCTCTTCCGCCGCATACCCATCATGATGGCCCTCAAG
CCTCTCATACCGGATGTCAAGAACTGGAGAGAGGCCCTGTTCGCCGGCCACTTCGGCCCCATTGGCGTCGGCGCC
ATCTTCGTCGCCATCCTCGCCAGGGCCGAGCTGGAGCACGAGGAGCCCGTGCCGCTGGCCGAGATGCCGCCACCG
GACTCGGAGAACTACGAGCTGATTTACCTCGTATGGCCCATCGTCACCTTTCTCGTTATCTCGTCCATCCTCATA
CACGGCTCTTCTGTCGCCGTCTTCACCCTCGGCAAGCGCATCAACACGTTGACCTTGACCATGTCGTACACGGCC
GCTCCCGACGACGGGCCCTCGTGGATGAACAGGCTGCCCCGCATCTCGTCCCAGTCCCGATCGCAGGCCAAGACT
ATGTCGGACGCCTCCTTCGACGACCCCAAGGAACCCGAGTTCCCGGCCGGCACGCTGGCGCCCCCCTCCGGCTTC
CTGCGTCGCCAGAGAGATGAGGACAACCCGAGCCGGACCGGGAGCCGGGCCTCGTCCCTGGTGTCCAAAAAGCGG
AAGAGCAAGAAGTGGGACGACGGCATAGGCCCCGGCGGCCCCGTGAGCCAGTCCGCCATCTTTCCCAGCCGGCCG
CCGCTCCTGAGCGGCAACTCGGAGAAGGAGCCGTCTCCGCCCGCCCGCGAGAACACCGACTCGACCACGCTGTCA
GAGAGCAGCCCGAAAGAGAAGGATACGGAAAGATCGGGCCCCGAGAGCAGCGACAGCCCGCGGACACAGCAGGGC
TCCCGAACCCCTCGAGTCGAGTTGTACGAGGAAGGCGATCAGATCGTCATCGAGAACGAGGACGGAGACGTGCTG
GATGTCCAGCCGACCCCCAATCCGCTCGAGCAAGAACTCGCGCCTCCCAGCAGGCGGCCTCGACCGGGCCCCAGC
AGCGAGCCCTTCAACTGGTCCTTTGGCGGTCTTCGGCGGAAGATGAGCGAGGTCTACAGCTCGGAGATGGAGAAG
CGTAAGGATAAGGGGAAGAGCCACCGACGTCACGAGCCGGCGCGGGCCTATCAGTTCGGCAACATGGTACGTATC
CCTTTCGTGCTGCCCCCTCGTGTATGTCTCGCCGCAGTCTTCTTCGACTGACCACGTGCCGCGATCTCAGATCAT
CGTCGAGGACGAGGACGGAGAAGTCGTCAAGACGTACGAACTGCCCTCGCAGAGGAGCGAAAGCCAGGAGGGCGG
CGACCTGCTCGTCTCCAGCTTGAAGTATCTCGGCCTCGGCGCCCGGTCACGTCCGGGCGAGAAGAGCAGCGAAGC
CGCCGCGGCCGAGGAGGGCCGGGCGGGAGAAACGACCCCGGGCAAGCAGCCGGCCAGGTCGGGATGGGGCGGCTT
CGGTAGGGGCGGCGCGGAGCAGGCCCGGAAGAAGAGCTTCGCGCTGCAGCAAGAGGCGGACGACGACAAGAAGAT
TCGTTTCACAATCGGGGGGGTTGGCCAGCGCATGACGAAGGAGGACTTCATCAGGGAGGTCCAGAAACTGGATGT
CAGGACGCGCAAAGAGGTTGTGGACCACTCGACGGCGTCGTCGGCCGTCAAGAAACTCGCGCAGCAGGGCCCGCC
GTCCCGGTCGACGGCCACGCCGTCCGTGCCGGTGATCCGGGAGCACAGCAGCGACAACAGCAAGGCGGGGAGCGG
CTACTTCGGACCGCAACAGTCCGGGTCCCTCTCGCCGGTGCCGCCGCCGACGGGCTCGTCGGGCCTGTCGCCGAC
GTCGCGTGACCGGCCGTCGGAGATACAGGGCGAGACGCCCGTGGAACGCAGGCGGCGGCTGGCCGTGCTGGCGGG
CCAGGCCGAGGAGGGCGAGGACACGGGCGAAACGCCGGCGGAGCGGCGGCGGCGGCAGGCCGCGCTGGGCGTGAC
GGGCACGGAGATCGCCGAGGAGAGCGACAGCGAGGACGAGGGCACGGAGCGGGTGCCGCCAGCTCGGAGAGGTAT
TAGGTTCGCCGAGCCGCAGCGGAGTGGGAAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail