Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6749
Gene name
LocationContig_359:19020..21609
Strand+
Gene length (bp)2589
Transcript length (bp)2211
Coding sequence length (bp)2211
Protein length (aa) 737

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07034 ORC3_N Origin recognition complex (ORC) subunit 3 N-terminus 1.9E-37 58 347
PF18137 ORC_WH_C Origin recognition complex winged helix C-terminal 1.5E-31 612 735

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JK30|ORC3_MOUSE Origin recognition complex subunit 3 OS=Mus musculus GN=Orc3 PE=1 SV=1 50 735 9.0E-38
sp|Q9UBD5|ORC3_HUMAN Origin recognition complex subunit 3 OS=Homo sapiens GN=ORC3 PE=1 SV=1 19 735 5.0E-37
sp|Q5DJU3|ORC3_SPECI Origin recognition complex subunit 3 OS=Spermophilus citellus GN=ORC3 PE=2 SV=1 64 735 2.0E-36
sp|Q32PJ3|ORC3_BOVIN Origin recognition complex subunit 3 OS=Bos taurus GN=ORC3 PE=2 SV=1 64 735 1.0E-35
sp|Q4R180|ORC3_RAT Origin recognition complex subunit 3 OS=Rattus norvegicus GN=Orc3 PE=2 SV=1 19 735 7.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JK30|ORC3_MOUSE Origin recognition complex subunit 3 OS=Mus musculus GN=Orc3 PE=1 SV=1 50 735 9.0E-38
sp|Q9UBD5|ORC3_HUMAN Origin recognition complex subunit 3 OS=Homo sapiens GN=ORC3 PE=1 SV=1 19 735 5.0E-37
sp|Q5DJU3|ORC3_SPECI Origin recognition complex subunit 3 OS=Spermophilus citellus GN=ORC3 PE=2 SV=1 64 735 2.0E-36
sp|Q32PJ3|ORC3_BOVIN Origin recognition complex subunit 3 OS=Bos taurus GN=ORC3 PE=2 SV=1 64 735 1.0E-35
sp|Q4R180|ORC3_RAT Origin recognition complex subunit 3 OS=Rattus norvegicus GN=Orc3 PE=2 SV=1 19 735 7.0E-34
sp|Q10067|ORC3_SCHPO Origin recognition complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orc3 PE=1 SV=2 41 735 2.0E-23
sp|Q6E7H0|ORC3_ARATH Origin of replication complex subunit 3 OS=Arabidopsis thaliana GN=ORC3 PE=1 SV=1 549 735 5.0E-11
sp|Q0IY07|ORC3_ORYSJ Origin of replication complex subunit 3 OS=Oryza sativa subsp. japonica GN=ORC3 PE=2 SV=1 529 733 4.0E-09
sp|Q0IY07|ORC3_ORYSJ Origin of replication complex subunit 3 OS=Oryza sativa subsp. japonica GN=ORC3 PE=2 SV=1 72 347 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0005664 nuclear origin of replication recognition complex Yes
GO:0006260 DNA replication Yes
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006259 DNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0044428 nuclear part No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0044237 cellular metabolic process No
GO:0000808 origin recognition complex No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:0044422 organelle part No
GO:0005575 cellular_component No
GO:0090304 nucleic acid metabolic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044427 chromosomal part No
GO:0044454 nuclear chromosome part No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0044464 cell part No
GO:1901576 organic substance biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044446 intracellular organelle part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6749
MGVEDDSHVVFSQEDHQVAYIFNPDEDEVRGERPSKRRRVSKEAKRTEAPADEAGSLFVPLLNGAEKAECVRLRQ
QLFEESWARIDGRIQSILRESNRSTLDQVSAFVTAAEMQCARQIPAAFIITGPNLASQDLLFEQLSETLRQSFAS
KLVRLRSSEAATLKAALKKTIRDATASDAAEEEDGGAHVRPGQDGQRYLDYDLEALEACLEGEKCKHVFVAFQDS
EGFESGLISDLITLFHSWRPRIPFTLLFGIATSVELLQARLLKSACRLVYGAQFDCVQTETILEAVFRAAVAADD
VPLRLGAPLLRSMLDRQREQIAGIQAFISSLKYAYMCHFYANPLSILLSSDALAGKAMQAEHVEALRNLASFRDH
VERAIEAGGKESLAHARALIEDDGYLLSKAGETERRRREWSGKMLRSILVAEAATAGEQGGRAFSEAYLRAAAGA
ATEQAKLVELIRRKSADELSAFVGRVIELLRDGDDSLRLGGSGEDEEAAELQRGLERQLAEVDGLRAAASSGGFR
LQSRYSGKSKVMRTTVIAQRVQLSRDSAALRDEDRRLTEAVDRVGEMLTRQAGRAGGPESVLFWESWLYESRSPL
REVLVPRPRGVFERSLARPHDYLGCSCCGGSGSGSNGDPGMRATLPATCILYRLYLETGSLINVADLWSAFQGVV
KGQGEEKKRQQQQQQREEAEEEEEERASLVQFYRGLAELRALGFVKGSRKKTDHIAKVKWL*
Coding >Hirsu2|6749
ATGGGTGTCGAAGATGACTCTCACGTCGTGTTTTCCCAGGAAGACCACCAGGTGGCCTACATCTTCAACCCCGAC
GAGGACGAGGTTCGCGGCGAGCGCCCGTCGAAGCGGCGCAGGGTGTCGAAGGAAGCCAAGAGAACGGAGGCGCCG
GCTGACGAGGCCGGATCGCTGTTCGTCCCGCTGCTCAACGGGGCGGAGAAGGCGGAATGCGTGCGGCTGCGACAG
CAGCTTTTCGAAGAGAGCTGGGCGCGAATCGATGGCCGCATACAGAGTATCTTGCGCGAATCCAATCGGTCTACA
CTGGACCAGGTCTCGGCATTTGTGACCGCGGCAGAGATGCAATGCGCGCGCCAAATCCCGGCGGCGTTCATCATC
ACGGGACCGAACCTTGCGTCGCAAGACCTGCTGTTCGAGCAGCTATCGGAGACGCTTCGGCAGTCGTTCGCCAGC
AAGCTGGTGCGGCTGAGGTCTTCGGAGGCGGCGACGCTCAAGGCGGCTCTCAAGAAGACTATCCGAGACGCGACG
GCGAGCGACGCGGCCGAGGAGGAGGATGGAGGGGCACATGTGCGCCCCGGGCAGGATGGGCAGCGTTACCTCGAC
TACGACCTAGAGGCTCTCGAGGCGTGCCTAGAGGGGGAAAAGTGCAAGCATGTCTTCGTCGCCTTCCAAGACAGC
GAAGGCTTTGAAAGCGGGCTGATTTCTGATCTAATAACCCTATTCCATTCCTGGCGGCCTCGGATCCCCTTCACG
CTCCTCTTTGGCATCGCCACCTCGGTCGAGCTCCTGCAAGCTCGGCTGTTGAAGTCGGCGTGCCGTCTCGTCTAC
GGCGCGCAGTTCGACTGCGTGCAGACGGAGACGATCCTGGAGGCCGTGTTCCGAGCAGCGGTGGCGGCTGACGAC
GTGCCGCTTCGGCTGGGAGCGCCGCTGCTCCGGAGCATGCTGGACCGACAGCGCGAGCAGATTGCCGGCATCCAG
GCCTTCATCAGCTCACTGAAGTACGCATACATGTGTCACTTCTACGCCAACCCGCTCAGCATCTTGCTGTCGTCG
GACGCCCTCGCAGGCAAGGCGATGCAAGCCGAGCACGTCGAGGCGCTACGCAACCTGGCATCGTTCCGCGATCAC
GTGGAGCGAGCGATCGAGGCGGGCGGCAAGGAATCGCTGGCGCACGCCAGGGCACTAATCGAGGACGACGGCTAC
CTGCTCAGCAAAGCGGGGGAGACGGAGCGGCGGCGGCGGGAATGGAGCGGCAAGATGCTACGGTCGATCCTGGTG
GCGGAGGCGGCAACGGCAGGCGAGCAGGGCGGCCGGGCATTCTCCGAGGCCTATCTGCGCGCGGCGGCCGGGGCG
GCGACGGAGCAGGCCAAGCTGGTGGAGCTGATCCGACGGAAGAGCGCGGACGAGCTGTCCGCCTTTGTCGGCCGC
GTCATCGAGCTGTTGAGGGACGGAGACGACAGCCTCAGGCTGGGCGGGTCGGGCGAGGACGAGGAGGCGGCGGAG
CTGCAGAGGGGCCTGGAGAGGCAGCTGGCCGAGGTGGACGGGCTCCGGGCGGCGGCGTCGTCGGGGGGCTTCCGG
CTGCAGAGCCGGTACAGCGGGAAGAGCAAGGTGATGCGGACGACGGTGATTGCGCAGCGGGTGCAGCTGAGCCGG
GACTCGGCGGCGCTCCGGGACGAGGACAGGCGTCTGACGGAGGCGGTGGACCGGGTGGGCGAGATGCTCACGCGG
CAGGCGGGCCGGGCGGGCGGGCCGGAGAGCGTCCTGTTCTGGGAGAGCTGGCTCTACGAGTCGCGGTCGCCGCTG
CGCGAGGTGTTGGTGCCACGGCCACGGGGGGTGTTTGAACGAAGCCTGGCTCGGCCGCACGACTACCTGGGCTGC
TCGTGCTGCGGGGGCTCGGGCTCGGGCTCGAACGGGGACCCGGGGATGCGGGCGACGCTGCCGGCGACGTGCATC
CTGTACCGGCTATACCTCGAGACGGGCAGCCTGATCAACGTGGCGGACCTGTGGTCGGCCTTCCAGGGGGTGGTC
AAGGGGCAGGGCGAGGAGAAGAAGAGGCAGCAGCAGCAGCAGCAGCGGGAGGAGGCAGAGGAGGAGGAAGAGGAG
CGGGCGAGTCTGGTGCAGTTCTACCGGGGCCTGGCCGAGCTGCGGGCGTTGGGCTTCGTCAAGGGCAGCAGGAAG
AAGACGGATCACATCGCCAAGGTGAAATGGCTATGA
Transcript >Hirsu2|6749
ATGGGTGTCGAAGATGACTCTCACGTCGTGTTTTCCCAGGAAGACCACCAGGTGGCCTACATCTTCAACCCCGAC
GAGGACGAGGTTCGCGGCGAGCGCCCGTCGAAGCGGCGCAGGGTGTCGAAGGAAGCCAAGAGAACGGAGGCGCCG
GCTGACGAGGCCGGATCGCTGTTCGTCCCGCTGCTCAACGGGGCGGAGAAGGCGGAATGCGTGCGGCTGCGACAG
CAGCTTTTCGAAGAGAGCTGGGCGCGAATCGATGGCCGCATACAGAGTATCTTGCGCGAATCCAATCGGTCTACA
CTGGACCAGGTCTCGGCATTTGTGACCGCGGCAGAGATGCAATGCGCGCGCCAAATCCCGGCGGCGTTCATCATC
ACGGGACCGAACCTTGCGTCGCAAGACCTGCTGTTCGAGCAGCTATCGGAGACGCTTCGGCAGTCGTTCGCCAGC
AAGCTGGTGCGGCTGAGGTCTTCGGAGGCGGCGACGCTCAAGGCGGCTCTCAAGAAGACTATCCGAGACGCGACG
GCGAGCGACGCGGCCGAGGAGGAGGATGGAGGGGCACATGTGCGCCCCGGGCAGGATGGGCAGCGTTACCTCGAC
TACGACCTAGAGGCTCTCGAGGCGTGCCTAGAGGGGGAAAAGTGCAAGCATGTCTTCGTCGCCTTCCAAGACAGC
GAAGGCTTTGAAAGCGGGCTGATTTCTGATCTAATAACCCTATTCCATTCCTGGCGGCCTCGGATCCCCTTCACG
CTCCTCTTTGGCATCGCCACCTCGGTCGAGCTCCTGCAAGCTCGGCTGTTGAAGTCGGCGTGCCGTCTCGTCTAC
GGCGCGCAGTTCGACTGCGTGCAGACGGAGACGATCCTGGAGGCCGTGTTCCGAGCAGCGGTGGCGGCTGACGAC
GTGCCGCTTCGGCTGGGAGCGCCGCTGCTCCGGAGCATGCTGGACCGACAGCGCGAGCAGATTGCCGGCATCCAG
GCCTTCATCAGCTCACTGAAGTACGCATACATGTGTCACTTCTACGCCAACCCGCTCAGCATCTTGCTGTCGTCG
GACGCCCTCGCAGGCAAGGCGATGCAAGCCGAGCACGTCGAGGCGCTACGCAACCTGGCATCGTTCCGCGATCAC
GTGGAGCGAGCGATCGAGGCGGGCGGCAAGGAATCGCTGGCGCACGCCAGGGCACTAATCGAGGACGACGGCTAC
CTGCTCAGCAAAGCGGGGGAGACGGAGCGGCGGCGGCGGGAATGGAGCGGCAAGATGCTACGGTCGATCCTGGTG
GCGGAGGCGGCAACGGCAGGCGAGCAGGGCGGCCGGGCATTCTCCGAGGCCTATCTGCGCGCGGCGGCCGGGGCG
GCGACGGAGCAGGCCAAGCTGGTGGAGCTGATCCGACGGAAGAGCGCGGACGAGCTGTCCGCCTTTGTCGGCCGC
GTCATCGAGCTGTTGAGGGACGGAGACGACAGCCTCAGGCTGGGCGGGTCGGGCGAGGACGAGGAGGCGGCGGAG
CTGCAGAGGGGCCTGGAGAGGCAGCTGGCCGAGGTGGACGGGCTCCGGGCGGCGGCGTCGTCGGGGGGCTTCCGG
CTGCAGAGCCGGTACAGCGGGAAGAGCAAGGTGATGCGGACGACGGTGATTGCGCAGCGGGTGCAGCTGAGCCGG
GACTCGGCGGCGCTCCGGGACGAGGACAGGCGTCTGACGGAGGCGGTGGACCGGGTGGGCGAGATGCTCACGCGG
CAGGCGGGCCGGGCGGGCGGGCCGGAGAGCGTCCTGTTCTGGGAGAGCTGGCTCTACGAGTCGCGGTCGCCGCTG
CGCGAGGTGTTGGTGCCACGGCCACGGGGGGTGTTTGAACGAAGCCTGGCTCGGCCGCACGACTACCTGGGCTGC
TCGTGCTGCGGGGGCTCGGGCTCGGGCTCGAACGGGGACCCGGGGATGCGGGCGACGCTGCCGGCGACGTGCATC
CTGTACCGGCTATACCTCGAGACGGGCAGCCTGATCAACGTGGCGGACCTGTGGTCGGCCTTCCAGGGGGTGGTC
AAGGGGCAGGGCGAGGAGAAGAAGAGGCAGCAGCAGCAGCAGCAGCGGGAGGAGGCAGAGGAGGAGGAAGAGGAG
CGGGCGAGTCTGGTGCAGTTCTACCGGGGCCTGGCCGAGCTGCGGGCGTTGGGCTTCGTCAAGGGCAGCAGGAAG
AAGACGGATCACATCGCCAAGGTGAAATGGCTATGA
Gene >Hirsu2|6749
ATGGGTGTCGAAGATGACTCTCACGTCGTGTTTTCCCAGGAAGACCACCAGGTAGGCTGCGTCCTGTTCCGAGCC
CCAGACTGCGTTGCTGACGAAGGAAGAAAAAGGTGGCCTACATCTTCAACCCCGACGAGGACGAGGTTCGCGGCG
AGCGCCCGTCGAAGCGGCGCAGGGTGTCGAAGGAAGCCAAGAGAACGGAGGCGCCGGCTGACGAGGCCGGATCGC
TGTTCGTCCCGCTGCTCAACGGGGCGGAGAAGGCGGAATGCGTGCGGCTGCGACAGCAGCTTTTCGAAGAGAGCT
GGGCGCGAATCGATGGCCGCATACAGGTAGGCAGTCTTCCTGCTCGCTTGCCTCGGCTCTGCGAGCGGCTGGCCG
TCTGACCTCTTGCCCCAGAGTATCTTGCGCGAATCCAATCGGTCTACACTGGACCAGGTCTCGGCATTTGTGACC
GCGGCAGAGATGCAATGGTAAGCGCCCTCGTGGTGTGCAGACGAGTGAGGAGTAGGAGTAGGCTGAGTCGAACCG
GACGAGCCATCAGCGCGCGCCAAATCCCGGCGGCGTTCATCATCACGGGACCGAACCTTGCGTCGCAAGACCTGC
TGTTCGAGCAGCTATCGGAGACGCTTCGGCAGTCGTTCGCCAGCAAGCTGGTGCGGCTGAGGTCTTCGGAGGCGG
CGACGCTCAAGGCGGCTCTCAAGAAGACTATCCGAGACGCGACGGCGAGCGACGCGGCCGAGGAGGAGGATGGAG
GGGCACATGTGCGCCCCGGGCAGGATGTGGGTTTTTTTGGTCGCTCGCCTCACGCAAACTCCGTCGTTGGCACTG
ACGCTCAGCTTGGCTCCCAGGGGCAGCGTTACCTCGACTACGACCTAGAGGCTCTCGAGGCGTGCCTAGAGGGGG
AAAAGTGCAAGCATGTCTTCGTCGCCTTCCAAGACAGCGAAGGCTTTGAAAGCGGGCTGATTTCTGATCTAATAA
CCCTATTCCAGTATGCGCTCCCTCGGTCCCCCCGCTCGCGAGGCTGGATGTGCTTGTTGACGCATGACAGTTCCT
GGCGGCCTCGGATCCCCTTCACGCTCCTCTTTGGCATCGCCACCTCGGTCGAGCTCCTGCAAGCTCGGCTGTTGA
AGTCGGCGTGCCGTCTCGTCTACGGCGCGCAGTTCGACTGCGTGCAGACGGAGACGATCCTGGAGGCCGTGTTCC
GAGCAGCGGTGGCGGCTGACGACGTGCCGCTTCGGCTGGGAGCGCCGCTGCTCCGGAGCATGCTGGACCGACAGC
GCGAGCAGATTGCCGGCATCCAGGCCTTCATCAGCTCACTGAAGGTAGGAGGCGAGTCGGGCGAGTGAGTTGGTG
GGCCGAGCTGATGGAAAAGCGCAGTACGCATACATGTGTCACTTCTACGCCAACCCGCTCAGCATCTTGCTGTCG
TCGGACGCCCTCGCAGGCAAGGCGATGCAAGCCGAGCACGTCGAGGCGCTACGCAACCTGGCATCGTTCCGCGAT
CACGTGGAGCGAGCGATCGAGGCGGGCGGCAAGGAATCGCTGGCGCACGCCAGGGCACTAATCGAGGACGACGGC
TACCTGCTCAGCAAAGCGGGGGAGACGGAGCGGCGGCGGCGGGAATGGAGCGGCAAGATGCTACGGTCGATCCTG
GTGGCGGAGGCGGCAACGGCAGGCGAGCAGGGCGGCCGGGCATTCTCCGAGGCCTATCTGCGCGCGGCGGCCGGG
GCGGCGACGGAGCAGGCCAAGCTGGTGGAGCTGATCCGACGGAAGAGCGCGGACGAGCTGTCCGCCTTTGTCGGC
CGCGTCATCGAGCTGTTGAGGGACGGAGACGACAGCCTCAGGCTGGGCGGGTCGGGCGAGGACGAGGAGGCGGCG
GAGCTGCAGAGGGGCCTGGAGAGGCAGCTGGCCGAGGTGGACGGGCTCCGGGCGGCGGCGTCGTCGGGGGGCTTC
CGGCTGCAGAGCCGGTACAGCGGGAAGAGCAAGGTGATGCGGACGACGGTGATTGCGCAGCGGGTGCAGCTGAGC
CGGGACTCGGCGGCGCTCCGGGACGAGGACAGGCGTCTGACGGAGGCGGTGGACCGGGTGGGCGAGATGCTCACG
CGGCAGGCGGGCCGGGCGGGCGGGCCGGAGAGCGTCCTGTTCTGGGAGAGCTGGCTCTACGAGTCGCGGTCGCCG
CTGCGCGAGGTGTTGGTGCCACGGCCACGGGGGGTGTTTGAACGAAGCCTGGCTCGGCCGCACGACTACCTGGGC
TGCTCGTGCTGCGGGGGCTCGGGCTCGGGCTCGAACGGGGACCCGGGGATGCGGGCGACGCTGCCGGCGACGTGC
ATCCTGTACCGGCTATACCTCGAGACGGGCAGCCTGATCAACGTGGCGGACCTGTGGTCGGCCTTCCAGGGGGTG
GTCAAGGGGCAGGGCGAGGAGAAGAAGAGGCAGCAGCAGCAGCAGCAGCGGGAGGAGGCAGAGGAGGAGGAAGAG
GAGCGGGCGAGTCTGGTGCAGTTCTACCGGGGCCTGGCCGAGCTGCGGGCGTTGGGCTTCGTCAAGGGCAGCAGG
AAGAAGACGGATCACATCGCCAAGGTGAAATGGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail