Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6733
Gene name
LocationContig_357:14545..17225
Strand-
Gene length (bp)2680
Transcript length (bp)2631
Coding sequence length (bp)2631
Protein length (aa) 877

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 4.7E-100 520 854
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 2.9E-81 216 517

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ2|ALP6_SCHPO Spindle pole body component alp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp6 PE=1 SV=2 69 860 1.0E-178
sp|P58854|GCP3_MOUSE Gamma-tubulin complex component 3 OS=Mus musculus GN=Tubgcp3 PE=1 SV=2 37 870 2.0E-112
sp|O73787|GCP3_XENLA Gamma-tubulin complex component 3 homolog OS=Xenopus laevis GN=tubgcp3 PE=1 SV=1 181 866 5.0E-111
sp|Q96CW5|GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens GN=TUBGCP3 PE=1 SV=2 181 866 3.0E-108
sp|Q9FG37|GACP3_ARATH Gamma-tubulin complex component 3 OS=Arabidopsis thaliana GN=GCP3 PE=1 SV=1 43 854 2.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ2|ALP6_SCHPO Spindle pole body component alp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp6 PE=1 SV=2 69 860 1.0E-178
sp|P58854|GCP3_MOUSE Gamma-tubulin complex component 3 OS=Mus musculus GN=Tubgcp3 PE=1 SV=2 37 870 2.0E-112
sp|O73787|GCP3_XENLA Gamma-tubulin complex component 3 homolog OS=Xenopus laevis GN=tubgcp3 PE=1 SV=1 181 866 5.0E-111
sp|Q96CW5|GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens GN=TUBGCP3 PE=1 SV=2 181 866 3.0E-108
sp|Q9FG37|GACP3_ARATH Gamma-tubulin complex component 3 OS=Arabidopsis thaliana GN=GCP3 PE=1 SV=1 43 854 2.0E-92
sp|Q95ZG4|SPC98_DICDI Spindle pole body component 98 OS=Dictyostelium discoideum GN=spc98 PE=1 SV=2 188 733 2.0E-80
sp|Q9XYP8|GCP3_DROME Gamma-tubulin complex component 3 homolog OS=Drosophila melanogaster GN=l(1)dd4 PE=1 SV=2 276 855 8.0E-70
sp|P53540|SPC98_YEAST Spindle pole body component SPC98 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC98 PE=1 SV=1 211 717 3.0E-49
sp|Q9BSJ2|GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens GN=TUBGCP2 PE=1 SV=2 212 732 2.0E-35
sp|Q921G8|GCP2_MOUSE Gamma-tubulin complex component 2 OS=Mus musculus GN=Tubgcp2 PE=1 SV=2 212 732 3.0E-35
sp|Q5R5J6|GCP2_PONAB Gamma-tubulin complex component 2 OS=Pongo abelii GN=TUBGCP2 PE=2 SV=1 212 732 9.0E-35
sp|Q9C5H9|GACP2_ARATH Gamma-tubulin complex component 2 OS=Arabidopsis thaliana GN=GCP2 PE=1 SV=1 238 732 2.0E-31
sp|Q9XYP7|GCP2_DROME Gamma-tubulin complex component 2 homolog OS=Drosophila melanogaster GN=Grip84 PE=1 SV=2 354 732 4.0E-25
sp|Q9SC88|GCP4_MEDTR Gamma-tubulin complex component 4 homolog OS=Medicago truncatula GN=85P PE=2 SV=1 347 732 5.0E-19
sp|Q95ZG3|SPC97_DICDI Spindle pole body component 97 OS=Dictyostelium discoideum GN=spc97 PE=2 SV=2 276 573 9.0E-16
sp|Q9M350|GACP4_ARATH Gamma-tubulin complex component 4 OS=Arabidopsis thaliana GN=GCP4 PE=2 SV=2 494 732 2.0E-14
sp|Q96RT7|GCP6_HUMAN Gamma-tubulin complex component 6 OS=Homo sapiens GN=TUBGCP6 PE=1 SV=3 517 857 8.0E-14
sp|Q9D4F8|GCP4_MOUSE Gamma-tubulin complex component 4 OS=Mus musculus GN=Tubgcp4 PE=1 SV=2 351 735 8.0E-13
sp|Q9UGJ1|GCP4_HUMAN Gamma-tubulin complex component 4 OS=Homo sapiens GN=TUBGCP4 PE=1 SV=1 351 735 2.0E-12
sp|Q9Y705|ALP4_SCHPO Spindle pole body component alp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp4 PE=1 SV=1 356 571 3.0E-12
sp|Q96RT8|GCP5_HUMAN Gamma-tubulin complex component 5 OS=Homo sapiens GN=TUBGCP5 PE=1 SV=1 464 790 2.0E-11
sp|Q95K09|GCP5_MACFA Gamma-tubulin complex component 5 (Fragment) OS=Macaca fascicularis GN=TUBGCP5 PE=2 SV=2 464 790 6.0E-11
sp|Q9VKU7|GCP4_DROME Gamma-tubulin complex component 4 homolog OS=Drosophila melanogaster GN=Grip75 PE=1 SV=2 356 747 4.0E-10
sp|Q95ZG3|SPC97_DICDI Spindle pole body component 97 OS=Dictyostelium discoideum GN=spc97 PE=2 SV=2 599 830 8.0E-09
sp|Q9Y705|ALP4_SCHPO Spindle pole body component alp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp4 PE=1 SV=1 594 736 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0015631 tubulin binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6733
MAPDRIANAIDSLIAHLIPRNRRDDEAAAQDRHDACFALVKSIIDSPPSAAISSDVNHASDLIKRKLIQSNPSQA
LRFSNLYSRLLSLPVLEHKWAILFLLYQLADSPDPSQRIPLSPVKPSAPGYRDAVTREAIKRQNREKSRTSPQVP
RFEEEQFGDAFQPEGLRRFPPNEARQGDDEGQPPPQAGSANRDVSLKSTLQAGSHSEIDPPETALLRDLPFTLQG
LSSTSLPFLAHDALKLPPTLPLPLISILHTLAEPALLYRRLDAFCQSSPQGLLGQSLRSAIGSELRSYLSLIATL
EGQIRRALSEFDENQPARGGIGTAGVTLKRCVVWTREATMGLRLMCLMAEESEDKKGGQLISLIHGFSSSHGDPT
VAAFAERLLGSFTGPFYNMLRRWIYDGELVDPYVEFFVREQTPTDEGGTRKKGAGNVWEDKYEIDQGMIPTMMTQ
DFGQKVFLIGKSLNFIRHSCGDSVWVERYSKAASKELRYGDTATLEAWIDEAYKTTMKRLMELMADKFHLFAHLQ
ALKKYILLGQGDFIALLMESLAANLDRPAGAQYRHTLTAQLEHAIRGSNAQYDAPEVLRRLDARMLQLSHGDIGW
DCFTLEYKIEAPVDVVVTEWGNRQYLKVFNFLWRIKRVEFALLTTWRKCMTGSRGVLQSADAGVRQTWKLTRGTL
AEMIHFVGQLQYYILFEVIESSWGELQRRIRGEDCTLDDLIRAHERYLDDITHKGLLGAKRRQHGPEGEDERASY
LAQLSDILRLMLSYRDSVDGLYSWSVSDFTRRQEADVRGTEAAAAAAAAADGGVSSELPVLRERLRQLGSSFRTR
VQILLGDLAYQPDVDMRFLGVAMNFNDVYQPARRKSKTSTGGASSANVSKV*
Coding >Hirsu2|6733
ATGGCGCCCGACCGCATCGCCAACGCCATCGACAGCCTCATAGCCCATCTGATCCCCCGAAACCGCCGCGACGAC
GAGGCGGCCGCCCAAGACCGACACGATGCCTGCTTCGCGCTGGTCAAGTCCATCATCGACAGCCCGCCGAGCGCC
GCCATCTCGTCCGACGTCAACCACGCGTCGGACCTCATCAAGCGAAAGCTCATCCAGTCCAACCCCAGCCAAGCC
CTGCGCTTCTCCAACCTCTACTCTCGACTGCTTTCCCTGCCCGTCCTCGAGCACAAGTGGGCCATTCTCTTCCTG
CTCTACCAGCTCGCCGACTCGCCCGACCCCAGCCAACGGATACCGTTGAGCCCGGTCAAGCCGTCGGCGCCAGGC
TACCGCGACGCCGTCACCCGGGAGGCAATCAAGCGGCAAAACCGCGAAAAATCCAGAACGTCGCCCCAGGTGCCC
AGGTTTGAGGAGGAGCAGTTCGGCGATGCCTTCCAACCCGAGGGCCTTCGAAGGTTCCCCCCGAACGAGGCAAGG
CAAGGCGACGACGAGGGGCAGCCGCCGCCCCAGGCTGGTAGTGCAAATCGAGACGTGTCCCTCAAATCGACCCTC
CAGGCCGGCAGCCACAGCGAAATCGACCCGCCGGAGACGGCGCTGCTTCGGGATCTGCCGTTTACGCTGCAGGGC
CTCTCCTCCACCTCGCTGCCCTTCTTGGCACACGATGCGCTCAAGCTTCCGCCGACACTCCCGCTGCCGCTGATA
TCCATCCTGCACACGCTGGCCGAGCCGGCGCTGCTGTATCGCCGACTGGACGCCTTCTGCCAGAGCTCGCCGCAG
GGCCTCCTGGGCCAGAGCCTGCGTTCCGCCATCGGCAGCGAGCTGCGCTCGTACCTGAGCCTCATCGCCACCCTC
GAGGGGCAGATCCGGAGGGCGCTCAGCGAATTCGACGAGAACCAGCCGGCGCGGGGGGGCATCGGGACGGCGGGC
GTGACGCTCAAGCGGTGCGTCGTGTGGACGCGGGAAGCGACGATGGGGCTGCGGCTGATGTGCCTGATGGCGGAG
GAGTCGGAGGACAAGAAGGGCGGACAGCTGATCTCGCTCATCCACGGCTTCTCGTCGTCGCACGGAGACCCGACG
GTGGCGGCATTCGCGGAGCGGCTGCTGGGCAGCTTCACGGGGCCCTTCTACAACATGCTGCGGCGCTGGATCTAC
GACGGGGAGCTGGTGGACCCGTACGTCGAGTTCTTCGTGCGGGAGCAGACGCCGACGGACGAGGGCGGGACGCGG
AAGAAGGGGGCGGGCAACGTGTGGGAGGACAAGTACGAGATCGACCAGGGCATGATACCGACGATGATGACGCAG
GACTTTGGGCAGAAGGTGTTTCTGATCGGCAAGTCGCTCAACTTCATCCGGCACAGCTGCGGCGACTCGGTCTGG
GTGGAGCGCTACTCCAAGGCGGCGTCCAAGGAGCTGCGGTACGGCGACACGGCGACGCTGGAGGCGTGGATCGAC
GAGGCATACAAGACGACTATGAAGCGTCTCATGGAGCTCATGGCGGACAAGTTCCACCTGTTCGCGCACCTGCAG
GCGCTCAAGAAGTACATCTTGCTGGGCCAGGGCGACTTCATCGCGCTGCTGATGGAGTCGCTGGCGGCCAACCTG
GACCGGCCGGCGGGGGCGCAGTACCGGCACACGCTAACGGCGCAGCTGGAGCACGCGATCCGGGGGTCGAACGCG
CAGTACGACGCGCCCGAGGTGCTGCGGCGGCTGGACGCGCGGATGCTGCAGCTGTCGCACGGCGACATCGGCTGG
GACTGCTTCACGCTCGAGTACAAGATCGAGGCGCCGGTGGACGTGGTGGTGACGGAATGGGGCAACCGGCAGTAC
CTCAAGGTGTTCAACTTCCTGTGGCGCATCAAGCGGGTCGAGTTCGCGCTGCTGACGACGTGGCGGAAGTGCATG
ACGGGGTCGCGGGGCGTGCTGCAGAGCGCGGACGCGGGGGTGAGGCAGACGTGGAAGCTGACGCGCGGGACGCTG
GCGGAGATGATTCACTTCGTCGGCCAGCTCCAGTACTACATCCTGTTCGAGGTGATCGAGTCGTCGTGGGGCGAG
CTGCAGCGGCGGATCCGGGGCGAGGACTGCACGCTGGACGACCTGATCCGGGCGCACGAGCGCTACCTCGACGAC
ATCACGCACAAGGGCCTGCTGGGGGCCAAGCGGCGGCAGCACGGGCCGGAGGGGGAGGACGAGCGGGCGTCGTAC
CTGGCGCAGCTGAGCGACATCCTGAGGCTGATGCTCAGCTACCGGGACTCGGTGGACGGGCTGTACAGCTGGAGC
GTGTCGGACTTTACGCGGCGGCAGGAGGCCGACGTGCGCGGGACGGAGGCGGCGGCGGCGGCGGCGGCGGCGGCG
GACGGCGGGGTGTCGTCGGAGCTGCCGGTGCTGCGGGAGCGGCTCCGGCAGCTGGGGTCGTCGTTCCGGACCCGG
GTGCAGATCCTGCTGGGCGACCTGGCCTACCAGCCGGACGTGGACATGCGCTTCCTGGGCGTGGCCATGAACTTC
AACGACGTGTACCAGCCGGCGCGGCGGAAGAGCAAGACGTCGACGGGCGGCGCGTCGTCGGCCAACGTGTCCAAG
GTCTGA
Transcript >Hirsu2|6733
ATGGCGCCCGACCGCATCGCCAACGCCATCGACAGCCTCATAGCCCATCTGATCCCCCGAAACCGCCGCGACGAC
GAGGCGGCCGCCCAAGACCGACACGATGCCTGCTTCGCGCTGGTCAAGTCCATCATCGACAGCCCGCCGAGCGCC
GCCATCTCGTCCGACGTCAACCACGCGTCGGACCTCATCAAGCGAAAGCTCATCCAGTCCAACCCCAGCCAAGCC
CTGCGCTTCTCCAACCTCTACTCTCGACTGCTTTCCCTGCCCGTCCTCGAGCACAAGTGGGCCATTCTCTTCCTG
CTCTACCAGCTCGCCGACTCGCCCGACCCCAGCCAACGGATACCGTTGAGCCCGGTCAAGCCGTCGGCGCCAGGC
TACCGCGACGCCGTCACCCGGGAGGCAATCAAGCGGCAAAACCGCGAAAAATCCAGAACGTCGCCCCAGGTGCCC
AGGTTTGAGGAGGAGCAGTTCGGCGATGCCTTCCAACCCGAGGGCCTTCGAAGGTTCCCCCCGAACGAGGCAAGG
CAAGGCGACGACGAGGGGCAGCCGCCGCCCCAGGCTGGTAGTGCAAATCGAGACGTGTCCCTCAAATCGACCCTC
CAGGCCGGCAGCCACAGCGAAATCGACCCGCCGGAGACGGCGCTGCTTCGGGATCTGCCGTTTACGCTGCAGGGC
CTCTCCTCCACCTCGCTGCCCTTCTTGGCACACGATGCGCTCAAGCTTCCGCCGACACTCCCGCTGCCGCTGATA
TCCATCCTGCACACGCTGGCCGAGCCGGCGCTGCTGTATCGCCGACTGGACGCCTTCTGCCAGAGCTCGCCGCAG
GGCCTCCTGGGCCAGAGCCTGCGTTCCGCCATCGGCAGCGAGCTGCGCTCGTACCTGAGCCTCATCGCCACCCTC
GAGGGGCAGATCCGGAGGGCGCTCAGCGAATTCGACGAGAACCAGCCGGCGCGGGGGGGCATCGGGACGGCGGGC
GTGACGCTCAAGCGGTGCGTCGTGTGGACGCGGGAAGCGACGATGGGGCTGCGGCTGATGTGCCTGATGGCGGAG
GAGTCGGAGGACAAGAAGGGCGGACAGCTGATCTCGCTCATCCACGGCTTCTCGTCGTCGCACGGAGACCCGACG
GTGGCGGCATTCGCGGAGCGGCTGCTGGGCAGCTTCACGGGGCCCTTCTACAACATGCTGCGGCGCTGGATCTAC
GACGGGGAGCTGGTGGACCCGTACGTCGAGTTCTTCGTGCGGGAGCAGACGCCGACGGACGAGGGCGGGACGCGG
AAGAAGGGGGCGGGCAACGTGTGGGAGGACAAGTACGAGATCGACCAGGGCATGATACCGACGATGATGACGCAG
GACTTTGGGCAGAAGGTGTTTCTGATCGGCAAGTCGCTCAACTTCATCCGGCACAGCTGCGGCGACTCGGTCTGG
GTGGAGCGCTACTCCAAGGCGGCGTCCAAGGAGCTGCGGTACGGCGACACGGCGACGCTGGAGGCGTGGATCGAC
GAGGCATACAAGACGACTATGAAGCGTCTCATGGAGCTCATGGCGGACAAGTTCCACCTGTTCGCGCACCTGCAG
GCGCTCAAGAAGTACATCTTGCTGGGCCAGGGCGACTTCATCGCGCTGCTGATGGAGTCGCTGGCGGCCAACCTG
GACCGGCCGGCGGGGGCGCAGTACCGGCACACGCTAACGGCGCAGCTGGAGCACGCGATCCGGGGGTCGAACGCG
CAGTACGACGCGCCCGAGGTGCTGCGGCGGCTGGACGCGCGGATGCTGCAGCTGTCGCACGGCGACATCGGCTGG
GACTGCTTCACGCTCGAGTACAAGATCGAGGCGCCGGTGGACGTGGTGGTGACGGAATGGGGCAACCGGCAGTAC
CTCAAGGTGTTCAACTTCCTGTGGCGCATCAAGCGGGTCGAGTTCGCGCTGCTGACGACGTGGCGGAAGTGCATG
ACGGGGTCGCGGGGCGTGCTGCAGAGCGCGGACGCGGGGGTGAGGCAGACGTGGAAGCTGACGCGCGGGACGCTG
GCGGAGATGATTCACTTCGTCGGCCAGCTCCAGTACTACATCCTGTTCGAGGTGATCGAGTCGTCGTGGGGCGAG
CTGCAGCGGCGGATCCGGGGCGAGGACTGCACGCTGGACGACCTGATCCGGGCGCACGAGCGCTACCTCGACGAC
ATCACGCACAAGGGCCTGCTGGGGGCCAAGCGGCGGCAGCACGGGCCGGAGGGGGAGGACGAGCGGGCGTCGTAC
CTGGCGCAGCTGAGCGACATCCTGAGGCTGATGCTCAGCTACCGGGACTCGGTGGACGGGCTGTACAGCTGGAGC
GTGTCGGACTTTACGCGGCGGCAGGAGGCCGACGTGCGCGGGACGGAGGCGGCGGCGGCGGCGGCGGCGGCGGCG
GACGGCGGGGTGTCGTCGGAGCTGCCGGTGCTGCGGGAGCGGCTCCGGCAGCTGGGGTCGTCGTTCCGGACCCGG
GTGCAGATCCTGCTGGGCGACCTGGCCTACCAGCCGGACGTGGACATGCGCTTCCTGGGCGTGGCCATGAACTTC
AACGACGTGTACCAGCCGGCGCGGCGGAAGAGCAAGACGTCGACGGGCGGCGCGTCGTCGGCCAACGTGTCCAAG
GTCTGA
Gene >Hirsu2|6733
ATGGCGCCCGACCGCATCGCCAACGCCATCGACAGCCTCATAGCCCATCTGATCCCCCGAAACCGCCGCGACGAC
GAGGCGGCCGCCCAAGACCGACACGATGCCTGCTTCGCGCTGGTCAAGTCCATCATCGACAGGTGAGAGCCGCCG
AGGCCCGCTGCCTTCCGCTGCTGACGCCCGCCCCAGCCCGCCGAGCGCCGCCATCTCGTCCGACGTCAACCACGC
GTCGGACCTCATCAAGCGAAAGCTCATCCAGTCCAACCCCAGCCAAGCCCTGCGCTTCTCCAACCTCTACTCTCG
ACTGCTTTCCCTGCCCGTCCTCGAGCACAAGTGGGCCATTCTCTTCCTGCTCTACCAGCTCGCCGACTCGCCCGA
CCCCAGCCAACGGATACCGTTGAGCCCGGTCAAGCCGTCGGCGCCAGGCTACCGCGACGCCGTCACCCGGGAGGC
AATCAAGCGGCAAAACCGCGAAAAATCCAGAACGTCGCCCCAGGTGCCCAGGTTTGAGGAGGAGCAGTTCGGCGA
TGCCTTCCAACCCGAGGGCCTTCGAAGGTTCCCCCCGAACGAGGCAAGGCAAGGCGACGACGAGGGGCAGCCGCC
GCCCCAGGCTGGTAGTGCAAATCGAGACGTGTCCCTCAAATCGACCCTCCAGGCCGGCAGCCACAGCGAAATCGA
CCCGCCGGAGACGGCGCTGCTTCGGGATCTGCCGTTTACGCTGCAGGGCCTCTCCTCCACCTCGCTGCCCTTCTT
GGCACACGATGCGCTCAAGCTTCCGCCGACACTCCCGCTGCCGCTGATATCCATCCTGCACACGCTGGCCGAGCC
GGCGCTGCTGTATCGCCGACTGGACGCCTTCTGCCAGAGCTCGCCGCAGGGCCTCCTGGGCCAGAGCCTGCGTTC
CGCCATCGGCAGCGAGCTGCGCTCGTACCTGAGCCTCATCGCCACCCTCGAGGGGCAGATCCGGAGGGCGCTCAG
CGAATTCGACGAGAACCAGCCGGCGCGGGGGGGCATCGGGACGGCGGGCGTGACGCTCAAGCGGTGCGTCGTGTG
GACGCGGGAAGCGACGATGGGGCTGCGGCTGATGTGCCTGATGGCGGAGGAGTCGGAGGACAAGAAGGGCGGACA
GCTGATCTCGCTCATCCACGGCTTCTCGTCGTCGCACGGAGACCCGACGGTGGCGGCATTCGCGGAGCGGCTGCT
GGGCAGCTTCACGGGGCCCTTCTACAACATGCTGCGGCGCTGGATCTACGACGGGGAGCTGGTGGACCCGTACGT
CGAGTTCTTCGTGCGGGAGCAGACGCCGACGGACGAGGGCGGGACGCGGAAGAAGGGGGCGGGCAACGTGTGGGA
GGACAAGTACGAGATCGACCAGGGCATGATACCGACGATGATGACGCAGGACTTTGGGCAGAAGGTGTTTCTGAT
CGGCAAGTCGCTCAACTTCATCCGGCACAGCTGCGGCGACTCGGTCTGGGTGGAGCGCTACTCCAAGGCGGCGTC
CAAGGAGCTGCGGTACGGCGACACGGCGACGCTGGAGGCGTGGATCGACGAGGCATACAAGACGACTATGAAGCG
TCTCATGGAGCTCATGGCGGACAAGTTCCACCTGTTCGCGCACCTGCAGGCGCTCAAGAAGTACATCTTGCTGGG
CCAGGGCGACTTCATCGCGCTGCTGATGGAGTCGCTGGCGGCCAACCTGGACCGGCCGGCGGGGGCGCAGTACCG
GCACACGCTAACGGCGCAGCTGGAGCACGCGATCCGGGGGTCGAACGCGCAGTACGACGCGCCCGAGGTGCTGCG
GCGGCTGGACGCGCGGATGCTGCAGCTGTCGCACGGCGACATCGGCTGGGACTGCTTCACGCTCGAGTACAAGAT
CGAGGCGCCGGTGGACGTGGTGGTGACGGAATGGGGCAACCGGCAGTACCTCAAGGTGTTCAACTTCCTGTGGCG
CATCAAGCGGGTCGAGTTCGCGCTGCTGACGACGTGGCGGAAGTGCATGACGGGGTCGCGGGGCGTGCTGCAGAG
CGCGGACGCGGGGGTGAGGCAGACGTGGAAGCTGACGCGCGGGACGCTGGCGGAGATGATTCACTTCGTCGGCCA
GCTCCAGTACTACATCCTGTTCGAGGTGATCGAGTCGTCGTGGGGCGAGCTGCAGCGGCGGATCCGGGGCGAGGA
CTGCACGCTGGACGACCTGATCCGGGCGCACGAGCGCTACCTCGACGACATCACGCACAAGGGCCTGCTGGGGGC
CAAGCGGCGGCAGCACGGGCCGGAGGGGGAGGACGAGCGGGCGTCGTACCTGGCGCAGCTGAGCGACATCCTGAG
GCTGATGCTCAGCTACCGGGACTCGGTGGACGGGCTGTACAGCTGGAGCGTGTCGGACTTTACGCGGCGGCAGGA
GGCCGACGTGCGCGGGACGGAGGCGGCGGCGGCGGCGGCGGCGGCGGCGGACGGCGGGGTGTCGTCGGAGCTGCC
GGTGCTGCGGGAGCGGCTCCGGCAGCTGGGGTCGTCGTTCCGGACCCGGGTGCAGATCCTGCTGGGCGACCTGGC
CTACCAGCCGGACGTGGACATGCGCTTCCTGGGCGTGGCCATGAACTTCAACGACGTGTACCAGCCGGCGCGGCG
GAAGAGCAAGACGTCGACGGGCGGCGCGTCGTCGGCCAACGTGTCCAAGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail