Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6729
Gene name
LocationContig_357:6..6323
Strand+
Gene length (bp)6317
Transcript length (bp)5811
Coding sequence length (bp)5811
Protein length (aa) 1937

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 7.5E-55 1520 1697
PF14765 PS-DH Polyketide synthase dehydratase 2.8E-46 249 529
PF08242 Methyltransf_12 Methyltransferase domain 1.4E-18 785 892
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 9.2E-16 1322 1427
PF13649 Methyltransf_25 Methyltransferase domain 1.1E-14 784 890
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.4E-12 1359 1496
PF00698 Acyl_transf_1 Acyl transferase domain 1.0E-14 20 187
PF08241 Methyltransf_11 Methyltransferase domain 4.6E-13 785 894
PF13847 Methyltransf_31 Methyltransferase domain 6.4E-12 780 898
PF13489 Methyltransf_23 Methyltransferase domain 4.8E-10 779 942
PF00550 PP-binding Phosphopantetheine attachment site 7.3E-09 1823 1887
PF00106 adh_short short chain dehydrogenase 1.5E-07 1523 1669
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 7.7E-06 773 901

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 21 1893 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 1917 2.0E-104
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 1917 4.0E-102
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 1153 1.0E-82
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1132 1899 7.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 21 1893 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 1917 2.0E-104
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 1917 4.0E-102
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 1153 1.0E-82
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1132 1899 7.0E-76
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1132 1899 7.0E-76
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1132 1709 2.0E-69
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1178 1917 8.0E-68
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1178 1891 3.0E-63
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1178 1891 1.0E-62
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1185 1695 2.0E-62
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1177 1700 3.0E-62
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1177 1700 3.0E-62
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1177 1700 3.0E-62
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1177 1700 3.0E-62
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1177 1700 4.0E-62
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1206 1716 3.0E-57
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1185 1704 2.0E-52
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1185 1704 3.0E-51
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1185 1707 3.0E-51
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1202 1870 1.0E-50
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 21 1155 2.0E-49
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 838 1924 8.0E-49
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1185 1704 3.0E-47
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1185 1704 6.0E-45
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 781 1882 3.0E-40
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1491 1933 7.0E-37
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 781 1900 2.0E-35
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 781 1900 2.0E-35
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1206 1862 2.0E-32
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1202 1882 4.0E-32
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1202 1882 2.0E-31
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1206 1862 3.0E-31
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1202 1882 2.0E-30
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1207 1862 2.0E-30
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1500 1914 5.0E-30
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1202 1882 5.0E-29
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1 960 8.0E-29
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1202 1882 9.0E-29
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1200 1706 1.0E-28
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1202 1882 1.0E-28
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 21 936 3.0E-27
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1200 1919 1.0E-25
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1200 1893 4.0E-25
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1202 1882 5.0E-25
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1202 1882 8.0E-25
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1198 1862 9.0E-25
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1186 1890 2.0E-24
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1206 1862 2.0E-24
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1506 1885 2.0E-24
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1198 1862 1.0E-23
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1206 1862 2.0E-23
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1202 1883 2.0E-23
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1508 1920 6.0E-23
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1132 1914 1.0E-22
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1202 1889 1.0E-22
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 777 954 1.0E-21
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1202 1893 2.0E-21
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1200 1497 1.0E-20
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1202 1931 2.0E-20
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1202 1889 3.0E-20
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1202 1894 2.0E-19
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 663 982 3.0E-19
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 742 941 3.0E-19
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1206 1501 1.0E-18
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1202 1500 2.0E-18
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1233 1438 3.0E-18
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 781 950 5.0E-18
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1182 1439 5.0E-18
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 781 950 8.0E-18
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1510 1716 8.0E-18
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1514 1891 3.0E-17
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1514 1891 3.0E-17
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1202 1893 4.0E-17
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1514 1726 5.0E-17
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1234 1416 5.0E-17
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1536 1930 7.0E-17
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1206 1504 8.0E-17
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1182 1416 9.0E-17
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1182 1412 1.0E-16
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1234 1416 1.0E-16
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1206 1504 1.0E-16
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1234 1416 1.0E-16
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 750 945 2.0E-16
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 777 941 3.0E-16
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1180 1464 3.0E-16
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1183 1411 3.0E-16
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 781 945 4.0E-16
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1202 1441 5.0E-16
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1234 1416 6.0E-16
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 750 945 7.0E-16
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1 346 8.0E-16
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1182 1416 9.0E-16
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1 300 1.0E-15
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 750 945 1.0E-15
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1 300 2.0E-15
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 781 945 2.0E-15
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1 346 2.0E-15
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1202 1416 2.0E-15
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 781 945 3.0E-15
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 781 941 3.0E-15
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1 346 4.0E-15
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1234 1416 4.0E-15
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1173 1411 4.0E-15
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1 346 8.0E-15
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 6 301 1.0E-14
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 27 499 1.0E-14
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 27 499 1.0E-14
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 27 499 1.0E-14
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 27 499 1.0E-14
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 6 301 2.0E-14
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 781 945 2.0E-14
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1517 1905 2.0E-14
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 27 499 3.0E-14
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 21 300 3.0E-14
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1509 1694 4.0E-14
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 24 301 6.0E-14
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1182 1416 7.0E-14
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1516 1885 8.0E-14
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1516 1885 8.0E-14
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1516 1885 8.0E-14
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1 346 9.0E-14
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1543 1898 9.0E-14
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1 300 1.0E-13
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1 300 1.0E-13
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 21 300 1.0E-13
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1 300 2.0E-13
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 718 945 2.0E-13
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1543 1875 3.0E-13
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 781 950 3.0E-13
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1234 1498 3.0E-13
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1 304 4.0E-13
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 743 945 6.0E-13
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1 304 7.0E-13
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1254 1502 8.0E-13
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 23 301 1.0E-12
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1 346 1.0E-12
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1 446 1.0E-12
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1186 1496 1.0E-12
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 21 361 2.0E-12
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 785 941 2.0E-12
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1186 1496 2.0E-12
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1254 1502 2.0E-12
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1 346 3.0E-12
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 781 941 3.0E-12
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1 304 4.0E-12
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1 346 5.0E-12
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 785 946 6.0E-12
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 21 346 6.0E-12
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1517 1683 7.0E-12
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1155 1411 9.0E-12
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1 474 1.0E-11
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 785 941 1.0E-11
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1 304 1.0E-11
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1 346 2.0E-11
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 785 941 3.0E-11
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 785 941 3.0E-11
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 244 5.0E-11
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 9 346 7.0E-11
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1503 1718 1.0E-10
sp|P34055|INC11_HYPAT Protein indc11 OS=Hypocrea atroviridis GN=indc11 PE=2 SV=1 1190 1418 1.0E-10
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1 304 2.0E-10
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1501 1679 2.0E-10
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 232 2.0E-10
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 1197 1494 2.0E-10
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2 201 3.0E-10
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 5 496 3.0E-10
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 5 496 3.0E-10
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 5 496 3.0E-10
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1193 1411 3.0E-10
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1 346 6.0E-10
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 21 346 8.0E-10
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1197 1496 1.0E-09
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1197 1496 6.0E-09
sp|Q921W4|QORL1_MOUSE Quinone oxidoreductase-like protein 1 OS=Mus musculus GN=Cryzl1 PE=1 SV=1 1201 1487 8.0E-09
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1 300 1.0E-08
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1513 1702 1.0E-08
sp|Q59A28|QORL1_BOVIN Quinone oxidoreductase-like protein 1 OS=Bos taurus GN=CRYZL1 PE=2 SV=1 1201 1486 3.0E-08
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 21 300 4.0E-08
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 21 299 7.0E-08
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1522 1684 7.0E-08
sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 1265 1496 9.0E-08
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1 444 1.0E-07
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1513 1702 1.0E-07
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1513 1702 1.0E-07
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 23 238 1.0E-07
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1517 1924 2.0E-07
sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 1297 1501 2.0E-07
sp|O95825|QORL1_HUMAN Quinone oxidoreductase-like protein 1 OS=Homo sapiens GN=CRYZL1 PE=1 SV=2 1201 1486 2.0E-07
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1214 1411 3.0E-07
sp|C6CWS7|BIOC_PAESJ Malonyl-[acyl-carrier protein] O-methyltransferase OS=Paenibacillus sp. (strain JDR-2) GN=bioC PE=3 SV=1 783 942 5.0E-07
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 1193 1473 1.0E-06
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 1200 1498 1.0E-06
sp|Q14914|PTGR1_HUMAN Prostaglandin reductase 1 OS=Homo sapiens GN=PTGR1 PE=1 SV=2 1201 1497 2.0E-06
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 21 127 4.0E-06
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 1234 1412 4.0E-06
sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 1280 1497 5.0E-06
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 2 330 6.0E-06
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 1225 1411 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6729
MAVGLSADGARPHLDAAAGPLTLACVNSPENVTLAGDRSALEGLAERLKRQGVFCRMLQVKNAFHGPQMLSVGDE
YRGRLGDMAANDVSSTTSFYSTVHGIRVPPSTLTADYWVENLCSPVQLVAALDSIFCPGDGSPQTPTVVLELGAH
SALAGPFKQFKLARGGLKHVTYQSLLSRGQDAMRTALGAAASLWERGVDVDIKRINEPSSSTPPAVLTDLPAYCW
NHSTSYWHESRQSRNHRSPPAARHDLIGSRLDACNPLEPVWQNYLRLAELPWLRDHRVQGAIVFPAAGVVSAVVE
AVRQLEAGNADPLTGVELREFRMLQALVIPDAADAVEVSLHLKRRKLGMGSGAGGWLEFSFYSCQDGDAFVEHAC
GLVQAQLATPPAELDGGREQREEASVFRERWRGTGGSPGREKLTGREHYDFFDSIGLQYGKSFQAITGARLFEPV
AASPPATPGSLSSAMAFEATVVDTRSDMPGSCESEYLIHPTTLDSIWQATMGNLLLMDRSQRQTWVAAGAGTIKV
STAIARDPGAALYGICDAVVSPGGQTRSSVFVGDGTFDAYPWLVMEHVRASRLGASENAPEPPEETKNRTCAAPV
WKPDPDLAPAAVLLGRTEADDETDARFISDNAGLVRELCRIALRRLKKLRLDADGLPSHLRKYVEWMREQSRTPA
AGDATTPAGSPISRRDEAGEEEEEEEEERRAMEKLEDLTQKHPADGQLMRHVFASLDDIVAERVMAMEHLTANDY
LSTYYKDSFGLRKTQRCLCRWFDIKAHKTPALRILEVGAGTGSVTVPILEQLAFEDGDTPRFSTWTFTDISAGWL
EKAKVLLRKHEPRVEFKGLDIEVDPVEQGFEAESYDVVFAVNVFHATRDLRKTLENCRRLLKPGGSLVFAEISAR
DVFSRFIFGILPSWWSAEDRRSDSPLLREADWDEVLRSAGFSGNEVVRPDSLDVSRFPIVISTNTLGRNVASAKD
VVVVLPDDKTDPTAALAFAVCRELGRLGARTAVVKDLAAAADAVDKGKTVVSLLEYERPFLEAVSEDGFERAKHL
LLHCGELLWVTRSDAADGVGHPSMRTISGLLCCIKAEDPAAGLHELHFCRHLAGGIESAGDIIGRRLISIWRDGD
GDGDVTETTERDGHFCIQRWMPDKAMNDSLARATGADAEPRQARLVQPGRPLKLAVGQPGMLDTLHWVDDPVPSQ
PLAEDEVEIEARVLSPNFRDIMIAMGQLEAAGLGVEAAGIVRRVGPGVTKVSPGDRVACFTDAVFRTDPRAREPY
VMALPPSLSLEEGAATLASYGTAHWCLVEVGRLQKGESVLIHAGAGALGQAAIQVATMLGAEIYCTASTEAKKRT
MTSLGVRPDHIFSSRDLSFEKGIMRKTNGRGVDVVVNSLAGEALRKSWACIAPFGRFVEVGKRDAVANTGLDMEP
FLRGAAFVLVDALQVSTCQPKAWERTMETVMKLLGQGSVGLIQPITVHDVSDAVSVFRQMQQGGHTGKLVLRVTP
ESLVPVTPRRLAPLSLRPDASYLLVGGLGGLGRAQAVFMAERGARHLAFVSRSGAASATARDVLAKLAEAGVNAR
AYAGDVADKDRLREILADISRSMPPMRGVIHGAMALDDVLFHSMSHGQWVYATRPKIQGSWNLHELLPGTLDFFV
VLASRVGVSGAASQGAYAAGCAYQDALVHYRQARGLAAQSLDIGVMTDIGYVAEHDNVMKHYRSYGKRVTVGEQE
FLHTLRCALAGTADGESPLTRQLLLGAGTGGLEQLRRKEVPDVEFPWLRHGASLAYLRQLDIEVTDTPERQDDAC
DQPLQRLRQARSAEEAAEAVQDVLLARIATTMAVPVADIDAAKPLRAYGIDSLVAVELRNWLHAKVRTDVPVLAL
TGNTSISALSRSIASRSQLVPDAAKGGQAEPRDGQKTQQADGIPAKANRVPAKANGIPAQQ*
Coding >Hirsu2|6729
ATGGCCGTCGGCCTGTCCGCCGACGGGGCGCGTCCGCACCTGGACGCCGCCGCCGGCCCCTTGACGCTGGCCTGC
GTCAACAGCCCCGAAAACGTGACACTGGCGGGCGACCGCTCCGCCCTCGAGGGCCTGGCCGAGAGGCTGAAGCGG
CAGGGCGTCTTCTGCCGCATGCTGCAGGTGAAGAACGCTTTCCATGGTCCGCAGATGTTGAGCGTCGGCGACGAG
TACCGCGGGCGCCTCGGCGACATGGCCGCCAATGACGTCTCGTCGACGACGTCGTTCTATTCGACCGTCCACGGC
ATCCGGGTGCCCCCGTCGACGCTCACGGCCGACTACTGGGTGGAGAATCTATGCTCGCCCGTCCAGCTCGTCGCC
GCCCTCGACAGCATCTTCTGCCCCGGCGACGGCAGTCCCCAGACGCCCACCGTCGTCCTCGAGCTCGGCGCCCAC
AGCGCCCTCGCCGGGCCCTTCAAGCAGTTCAAGCTCGCCCGCGGCGGCCTGAAGCACGTCACCTACCAGAGCCTC
CTCTCGCGGGGCCAGGACGCGATGCGCACCGCCCTGGGCGCGGCCGCCTCGCTGTGGGAGAGGGGCGTCGACGTC
GACATCAAACGGATCAACGAGCCGTCATCGTCGACGCCGCCCGCCGTCCTCACCGACCTGCCGGCCTACTGCTGG
AACCACTCGACCTCGTACTGGCACGAGTCGCGCCAGTCCAGAAATCACCGCTCGCCGCCGGCCGCCAGGCACGAC
CTCATCGGGTCGCGCCTGGACGCGTGCAACCCGCTGGAGCCCGTGTGGCAGAACTACCTGCGGCTCGCGGAGCTG
CCCTGGCTCAGGGACCACCGGGTCCAGGGCGCCATCGTCTTCCCCGCGGCCGGCGTCGTGAGCGCCGTCGTCGAG
GCCGTGCGCCAGCTCGAGGCCGGCAACGCGGACCCCCTGACCGGCGTCGAGCTGCGCGAGTTCCGCATGCTGCAG
GCCCTCGTCATCCCCGACGCCGCCGACGCCGTCGAAGTCTCCCTCCACCTCAAGCGGAGGAAGCTGGGCATGGGC
AGCGGCGCCGGCGGCTGGCTCGAGTTCTCCTTCTACTCGTGCCAGGACGGCGACGCCTTCGTCGAGCACGCCTGC
GGGCTCGTCCAGGCCCAGCTCGCGACGCCGCCCGCCGAGCTGGACGGCGGCAGGGAGCAGCGCGAGGAGGCCAGC
GTCTTCCGGGAGCGCTGGAGAGGGACCGGCGGCTCGCCCGGGCGCGAGAAGCTGACGGGCCGGGAGCACTATGAC
TTCTTCGACAGCATCGGCCTCCAATACGGCAAAAGCTTCCAGGCCATCACCGGGGCCCGCCTTTTCGAGCCCGTC
GCGGCCTCGCCCCCCGCCACGCCCGGCTCTCTCTCGTCGGCCATGGCCTTTGAGGCGACCGTCGTGGACACGCGC
TCCGACATGCCGGGCTCGTGCGAGAGCGAGTACCTCATCCACCCGACGACGCTCGACTCGATTTGGCAGGCGACT
ATGGGCAATCTCCTCCTCATGGACCGTTCGCAGAGGCAGACCTGGGTCGCCGCCGGCGCCGGGACGATCAAAGTC
TCGACCGCCATCGCCCGTGATCCCGGGGCCGCGCTGTATGGCATCTGCGATGCTGTCGTCAGCCCGGGCGGGCAG
ACGAGGAGCTCCGTCTTCGTCGGCGACGGCACCTTCGACGCCTATCCTTGGCTCGTCATGGAGCATGTCAGGGCT
TCCAGGCTAGGGGCGTCGGAGAACGCGCCCGAGCCGCCGGAGGAAACGAAGAACAGGACGTGCGCGGCGCCCGTC
TGGAAGCCGGACCCGGATCTTGCCCCGGCGGCGGTCCTGCTGGGCCGGACCGAGGCCGACGACGAAACAGACGCC
CGCTTCATCTCCGATAACGCCGGCCTCGTCCGCGAGCTGTGCCGGATCGCCTTGAGAAGATTGAAGAAGCTCAGG
CTCGATGCTGATGGGCTGCCGTCCCACCTGCGCAAGTACGTCGAGTGGATGCGGGAGCAGAGCAGGACGCCGGCG
GCCGGCGACGCGACGACGCCTGCGGGAAGCCCCATCAGCCGCCGCGACGAGGCCGGGGAGGAGGAGGAGGAGGAG
GAGGAGGAGCGCCGGGCCATGGAGAAGCTGGAGGACCTCACCCAGAAGCACCCCGCCGACGGACAGCTGATGCGC
CACGTCTTCGCGTCGCTGGACGACATCGTCGCCGAGCGAGTGATGGCCATGGAGCACCTCACGGCCAACGACTAC
CTCTCGACATACTACAAAGATTCCTTCGGATTAAGAAAAACACAAAGGTGCCTATGCCGCTGGTTCGATATCAAG
GCGCACAAGACGCCGGCCCTGCGCATCCTCGAGGTCGGTGCCGGGACGGGGTCGGTAACGGTGCCCATCCTGGAG
CAGCTGGCATTCGAGGACGGCGACACGCCTCGCTTCTCCACCTGGACCTTCACCGACATCTCGGCCGGCTGGCTC
GAAAAGGCCAAGGTACTGTTGCGCAAGCACGAGCCCCGCGTCGAGTTCAAGGGCCTGGACATCGAGGTCGACCCC
GTCGAGCAGGGCTTCGAGGCCGAGTCGTACGACGTCGTCTTCGCCGTCAACGTCTTCCACGCCACCCGCGACCTG
CGGAAAACGCTCGAAAATTGCAGGCGCCTGCTGAAGCCCGGCGGGAGCCTAGTCTTTGCCGAGATCTCGGCCCGG
GACGTCTTCAGCCGCTTCATCTTCGGGATCCTGCCTAGCTGGTGGTCGGCCGAGGACCGGCGGAGCGACAGCCCA
CTGCTCCGCGAGGCCGATTGGGACGAGGTCCTCAGGTCGGCCGGCTTCTCCGGGAACGAGGTCGTTCGGCCCGAC
AGCTTGGACGTCTCTAGGTTCCCGATCGTGATCAGCACCAATACGCTCGGGCGGAACGTGGCCTCGGCCAAGGAC
GTCGTCGTCGTCCTGCCCGACGACAAGACGGACCCAACGGCCGCGCTCGCGTTCGCCGTCTGCCGCGAGCTCGGG
CGCCTCGGCGCGCGCACGGCCGTCGTCAAGGACCTCGCGGCGGCGGCGGACGCCGTCGACAAGGGCAAGACGGTC
GTCTCCCTCCTCGAGTACGAGAGGCCCTTCCTCGAGGCCGTCTCGGAGGACGGCTTCGAGCGGGCCAAGCACCTC
CTCCTCCACTGCGGCGAGCTCCTCTGGGTCACCAGGTCCGATGCCGCCGACGGCGTCGGCCACCCGAGCATGCGC
ACCATCTCCGGGCTCTTGTGCTGCATCAAGGCCGAGGACCCGGCCGCCGGGCTCCACGAGCTGCACTTTTGCCGG
CATCTCGCCGGCGGCATCGAGTCGGCCGGCGACATCATCGGCCGGCGGCTTATCAGCATCTGGCGCGACGGCGAC
GGCGACGGCGACGTGACGGAGACGACGGAGCGAGACGGGCACTTCTGCATCCAACGTTGGATGCCGGACAAGGCG
ATGAACGACAGCCTCGCGCGGGCCACCGGGGCGGACGCCGAGCCGCGCCAGGCCCGCCTCGTCCAGCCCGGCCGG
CCGCTGAAGCTGGCGGTCGGGCAGCCCGGCATGCTGGACACGCTCCACTGGGTCGACGACCCCGTCCCCTCGCAG
CCCTTGGCCGAGGACGAGGTCGAGATCGAGGCGCGGGTGTTGAGCCCCAACTTCCGGGACATCATGATCGCCATG
GGCCAGCTGGAAGCGGCCGGCTTGGGCGTCGAGGCGGCCGGCATCGTCCGCCGCGTGGGCCCCGGCGTCACCAAG
GTTTCCCCGGGCGACCGCGTCGCGTGCTTTACGGATGCCGTCTTCCGGACCGACCCCCGAGCCCGAGAGCCGTAC
GTCATGGCCTTGCCGCCGTCCTTGTCCCTCGAGGAGGGCGCTGCGACCCTGGCGTCCTATGGGACGGCGCACTGG
TGCCTGGTCGAGGTCGGCCGGCTGCAGAAGGGAGAGTCGGTGCTCATCCACGCCGGGGCCGGAGCCCTCGGCCAG
GCCGCCATCCAGGTGGCGACGATGCTGGGGGCCGAAATCTACTGCACCGCGAGCACCGAGGCGAAGAAGCGCACA
ATGACGTCCCTGGGCGTAAGGCCCGACCACATATTCAGCTCGCGCGACTTGTCGTTCGAAAAGGGCATCATGCGC
AAGACGAATGGCCGGGGCGTCGACGTAGTCGTCAACTCGCTGGCGGGTGAGGCGCTGCGCAAGAGCTGGGCTTGC
ATCGCGCCCTTTGGCCGCTTCGTCGAGGTCGGCAAGAGGGACGCTGTAGCCAATACTGGGCTCGATATGGAGCCC
TTTTTAAGGGGTGCCGCGTTTGTCTTGGTTGATGCACTACAGGTGTCGACCTGTCAGCCAAAGGCGTGGGAGAGG
ACGATGGAAACGGTGATGAAGCTGCTCGGCCAAGGCAGCGTCGGCCTGATCCAGCCCATCACAGTGCACGATGTA
TCCGACGCCGTGTCCGTCTTCCGTCAGATGCAGCAGGGGGGCCACACGGGCAAGCTGGTGCTCCGCGTCACGCCC
GAGTCGCTCGTACCCGTGACGCCGCGCAGGCTGGCCCCCCTCAGCCTCCGGCCGGACGCCAGCTACCTACTGGTC
GGCGGCCTCGGCGGTCTCGGCCGGGCCCAGGCGGTCTTCATGGCCGAGCGCGGCGCCCGCCATCTCGCCTTCGTC
TCGCGCTCCGGCGCCGCATCGGCCACAGCCCGAGACGTGCTCGCGAAGCTGGCCGAGGCCGGCGTCAACGCCAGG
GCGTACGCCGGCGACGTCGCGGACAAGGACCGGCTGAGGGAGATACTCGCCGATATATCCCGAAGCATGCCGCCG
ATGCGGGGCGTGATACATGGCGCCATGGCGCTCGACGATGTCCTGTTCCACAGTATGAGCCATGGCCAATGGGTC
TATGCGACCCGGCCCAAGATCCAAGGAAGCTGGAACCTGCACGAGCTGCTCCCCGGGACGCTCGACTTCTTCGTG
GTGCTGGCTTCAAGAGTTGGCGTCAGCGGCGCCGCCTCGCAGGGCGCCTACGCGGCCGGCTGCGCGTACCAGGAC
GCGCTGGTGCACTACCGACAGGCAAGGGGGCTGGCGGCGCAGAGCCTCGACATCGGCGTCATGACGGACATCGGC
TACGTTGCCGAGCACGACAACGTCATGAAACATTATCGATCTTACGGAAAGCGGGTAACGGTGGGCGAGCAAGAG
TTCCTTCATACCCTCCGCTGCGCGCTGGCCGGTACCGCTGACGGCGAGAGCCCGCTAACCCGGCAGCTCCTCCTC
GGGGCCGGCACCGGCGGCTTGGAGCAGCTGCGGCGGAAGGAGGTGCCGGACGTCGAATTCCCCTGGCTGCGGCAC
GGGGCGTCGTTGGCCTACCTGCGGCAGCTGGACATAGAGGTGACGGACACGCCGGAGAGACAAGATGATGCCTGC
GACCAGCCGCTGCAGCGGTTGCGGCAGGCCAGGTCGGCCGAGGAGGCGGCCGAGGCGGTGCAGGACGTGCTGCTG
GCGCGCATCGCCACGACGATGGCGGTGCCCGTGGCGGACATCGACGCGGCCAAGCCGCTGCGCGCGTACGGCATC
GACAGCTTAGTTGCCGTCGAGCTGCGCAACTGGCTGCACGCGAAGGTCCGGACCGACGTGCCAGTTCTGGCCCTG
ACGGGCAACACATCCATCAGCGCCCTCAGCAGGAGCATCGCAAGCAGGTCGCAGCTCGTGCCGGACGCGGCCAAG
GGGGGTCAGGCGGAGCCGCGCGACGGTCAGAAGACGCAGCAAGCGGATGGGATCCCGGCGAAAGCGAATCGAGTC
CCGGCGAAAGCGAACGGAATCCCAGCGCAGCAGTGA
Transcript >Hirsu2|6729
ATGGCCGTCGGCCTGTCCGCCGACGGGGCGCGTCCGCACCTGGACGCCGCCGCCGGCCCCTTGACGCTGGCCTGC
GTCAACAGCCCCGAAAACGTGACACTGGCGGGCGACCGCTCCGCCCTCGAGGGCCTGGCCGAGAGGCTGAAGCGG
CAGGGCGTCTTCTGCCGCATGCTGCAGGTGAAGAACGCTTTCCATGGTCCGCAGATGTTGAGCGTCGGCGACGAG
TACCGCGGGCGCCTCGGCGACATGGCCGCCAATGACGTCTCGTCGACGACGTCGTTCTATTCGACCGTCCACGGC
ATCCGGGTGCCCCCGTCGACGCTCACGGCCGACTACTGGGTGGAGAATCTATGCTCGCCCGTCCAGCTCGTCGCC
GCCCTCGACAGCATCTTCTGCCCCGGCGACGGCAGTCCCCAGACGCCCACCGTCGTCCTCGAGCTCGGCGCCCAC
AGCGCCCTCGCCGGGCCCTTCAAGCAGTTCAAGCTCGCCCGCGGCGGCCTGAAGCACGTCACCTACCAGAGCCTC
CTCTCGCGGGGCCAGGACGCGATGCGCACCGCCCTGGGCGCGGCCGCCTCGCTGTGGGAGAGGGGCGTCGACGTC
GACATCAAACGGATCAACGAGCCGTCATCGTCGACGCCGCCCGCCGTCCTCACCGACCTGCCGGCCTACTGCTGG
AACCACTCGACCTCGTACTGGCACGAGTCGCGCCAGTCCAGAAATCACCGCTCGCCGCCGGCCGCCAGGCACGAC
CTCATCGGGTCGCGCCTGGACGCGTGCAACCCGCTGGAGCCCGTGTGGCAGAACTACCTGCGGCTCGCGGAGCTG
CCCTGGCTCAGGGACCACCGGGTCCAGGGCGCCATCGTCTTCCCCGCGGCCGGCGTCGTGAGCGCCGTCGTCGAG
GCCGTGCGCCAGCTCGAGGCCGGCAACGCGGACCCCCTGACCGGCGTCGAGCTGCGCGAGTTCCGCATGCTGCAG
GCCCTCGTCATCCCCGACGCCGCCGACGCCGTCGAAGTCTCCCTCCACCTCAAGCGGAGGAAGCTGGGCATGGGC
AGCGGCGCCGGCGGCTGGCTCGAGTTCTCCTTCTACTCGTGCCAGGACGGCGACGCCTTCGTCGAGCACGCCTGC
GGGCTCGTCCAGGCCCAGCTCGCGACGCCGCCCGCCGAGCTGGACGGCGGCAGGGAGCAGCGCGAGGAGGCCAGC
GTCTTCCGGGAGCGCTGGAGAGGGACCGGCGGCTCGCCCGGGCGCGAGAAGCTGACGGGCCGGGAGCACTATGAC
TTCTTCGACAGCATCGGCCTCCAATACGGCAAAAGCTTCCAGGCCATCACCGGGGCCCGCCTTTTCGAGCCCGTC
GCGGCCTCGCCCCCCGCCACGCCCGGCTCTCTCTCGTCGGCCATGGCCTTTGAGGCGACCGTCGTGGACACGCGC
TCCGACATGCCGGGCTCGTGCGAGAGCGAGTACCTCATCCACCCGACGACGCTCGACTCGATTTGGCAGGCGACT
ATGGGCAATCTCCTCCTCATGGACCGTTCGCAGAGGCAGACCTGGGTCGCCGCCGGCGCCGGGACGATCAAAGTC
TCGACCGCCATCGCCCGTGATCCCGGGGCCGCGCTGTATGGCATCTGCGATGCTGTCGTCAGCCCGGGCGGGCAG
ACGAGGAGCTCCGTCTTCGTCGGCGACGGCACCTTCGACGCCTATCCTTGGCTCGTCATGGAGCATGTCAGGGCT
TCCAGGCTAGGGGCGTCGGAGAACGCGCCCGAGCCGCCGGAGGAAACGAAGAACAGGACGTGCGCGGCGCCCGTC
TGGAAGCCGGACCCGGATCTTGCCCCGGCGGCGGTCCTGCTGGGCCGGACCGAGGCCGACGACGAAACAGACGCC
CGCTTCATCTCCGATAACGCCGGCCTCGTCCGCGAGCTGTGCCGGATCGCCTTGAGAAGATTGAAGAAGCTCAGG
CTCGATGCTGATGGGCTGCCGTCCCACCTGCGCAAGTACGTCGAGTGGATGCGGGAGCAGAGCAGGACGCCGGCG
GCCGGCGACGCGACGACGCCTGCGGGAAGCCCCATCAGCCGCCGCGACGAGGCCGGGGAGGAGGAGGAGGAGGAG
GAGGAGGAGCGCCGGGCCATGGAGAAGCTGGAGGACCTCACCCAGAAGCACCCCGCCGACGGACAGCTGATGCGC
CACGTCTTCGCGTCGCTGGACGACATCGTCGCCGAGCGAGTGATGGCCATGGAGCACCTCACGGCCAACGACTAC
CTCTCGACATACTACAAAGATTCCTTCGGATTAAGAAAAACACAAAGGTGCCTATGCCGCTGGTTCGATATCAAG
GCGCACAAGACGCCGGCCCTGCGCATCCTCGAGGTCGGTGCCGGGACGGGGTCGGTAACGGTGCCCATCCTGGAG
CAGCTGGCATTCGAGGACGGCGACACGCCTCGCTTCTCCACCTGGACCTTCACCGACATCTCGGCCGGCTGGCTC
GAAAAGGCCAAGGTACTGTTGCGCAAGCACGAGCCCCGCGTCGAGTTCAAGGGCCTGGACATCGAGGTCGACCCC
GTCGAGCAGGGCTTCGAGGCCGAGTCGTACGACGTCGTCTTCGCCGTCAACGTCTTCCACGCCACCCGCGACCTG
CGGAAAACGCTCGAAAATTGCAGGCGCCTGCTGAAGCCCGGCGGGAGCCTAGTCTTTGCCGAGATCTCGGCCCGG
GACGTCTTCAGCCGCTTCATCTTCGGGATCCTGCCTAGCTGGTGGTCGGCCGAGGACCGGCGGAGCGACAGCCCA
CTGCTCCGCGAGGCCGATTGGGACGAGGTCCTCAGGTCGGCCGGCTTCTCCGGGAACGAGGTCGTTCGGCCCGAC
AGCTTGGACGTCTCTAGGTTCCCGATCGTGATCAGCACCAATACGCTCGGGCGGAACGTGGCCTCGGCCAAGGAC
GTCGTCGTCGTCCTGCCCGACGACAAGACGGACCCAACGGCCGCGCTCGCGTTCGCCGTCTGCCGCGAGCTCGGG
CGCCTCGGCGCGCGCACGGCCGTCGTCAAGGACCTCGCGGCGGCGGCGGACGCCGTCGACAAGGGCAAGACGGTC
GTCTCCCTCCTCGAGTACGAGAGGCCCTTCCTCGAGGCCGTCTCGGAGGACGGCTTCGAGCGGGCCAAGCACCTC
CTCCTCCACTGCGGCGAGCTCCTCTGGGTCACCAGGTCCGATGCCGCCGACGGCGTCGGCCACCCGAGCATGCGC
ACCATCTCCGGGCTCTTGTGCTGCATCAAGGCCGAGGACCCGGCCGCCGGGCTCCACGAGCTGCACTTTTGCCGG
CATCTCGCCGGCGGCATCGAGTCGGCCGGCGACATCATCGGCCGGCGGCTTATCAGCATCTGGCGCGACGGCGAC
GGCGACGGCGACGTGACGGAGACGACGGAGCGAGACGGGCACTTCTGCATCCAACGTTGGATGCCGGACAAGGCG
ATGAACGACAGCCTCGCGCGGGCCACCGGGGCGGACGCCGAGCCGCGCCAGGCCCGCCTCGTCCAGCCCGGCCGG
CCGCTGAAGCTGGCGGTCGGGCAGCCCGGCATGCTGGACACGCTCCACTGGGTCGACGACCCCGTCCCCTCGCAG
CCCTTGGCCGAGGACGAGGTCGAGATCGAGGCGCGGGTGTTGAGCCCCAACTTCCGGGACATCATGATCGCCATG
GGCCAGCTGGAAGCGGCCGGCTTGGGCGTCGAGGCGGCCGGCATCGTCCGCCGCGTGGGCCCCGGCGTCACCAAG
GTTTCCCCGGGCGACCGCGTCGCGTGCTTTACGGATGCCGTCTTCCGGACCGACCCCCGAGCCCGAGAGCCGTAC
GTCATGGCCTTGCCGCCGTCCTTGTCCCTCGAGGAGGGCGCTGCGACCCTGGCGTCCTATGGGACGGCGCACTGG
TGCCTGGTCGAGGTCGGCCGGCTGCAGAAGGGAGAGTCGGTGCTCATCCACGCCGGGGCCGGAGCCCTCGGCCAG
GCCGCCATCCAGGTGGCGACGATGCTGGGGGCCGAAATCTACTGCACCGCGAGCACCGAGGCGAAGAAGCGCACA
ATGACGTCCCTGGGCGTAAGGCCCGACCACATATTCAGCTCGCGCGACTTGTCGTTCGAAAAGGGCATCATGCGC
AAGACGAATGGCCGGGGCGTCGACGTAGTCGTCAACTCGCTGGCGGGTGAGGCGCTGCGCAAGAGCTGGGCTTGC
ATCGCGCCCTTTGGCCGCTTCGTCGAGGTCGGCAAGAGGGACGCTGTAGCCAATACTGGGCTCGATATGGAGCCC
TTTTTAAGGGGTGCCGCGTTTGTCTTGGTTGATGCACTACAGGTGTCGACCTGTCAGCCAAAGGCGTGGGAGAGG
ACGATGGAAACGGTGATGAAGCTGCTCGGCCAAGGCAGCGTCGGCCTGATCCAGCCCATCACAGTGCACGATGTA
TCCGACGCCGTGTCCGTCTTCCGTCAGATGCAGCAGGGGGGCCACACGGGCAAGCTGGTGCTCCGCGTCACGCCC
GAGTCGCTCGTACCCGTGACGCCGCGCAGGCTGGCCCCCCTCAGCCTCCGGCCGGACGCCAGCTACCTACTGGTC
GGCGGCCTCGGCGGTCTCGGCCGGGCCCAGGCGGTCTTCATGGCCGAGCGCGGCGCCCGCCATCTCGCCTTCGTC
TCGCGCTCCGGCGCCGCATCGGCCACAGCCCGAGACGTGCTCGCGAAGCTGGCCGAGGCCGGCGTCAACGCCAGG
GCGTACGCCGGCGACGTCGCGGACAAGGACCGGCTGAGGGAGATACTCGCCGATATATCCCGAAGCATGCCGCCG
ATGCGGGGCGTGATACATGGCGCCATGGCGCTCGACGATGTCCTGTTCCACAGTATGAGCCATGGCCAATGGGTC
TATGCGACCCGGCCCAAGATCCAAGGAAGCTGGAACCTGCACGAGCTGCTCCCCGGGACGCTCGACTTCTTCGTG
GTGCTGGCTTCAAGAGTTGGCGTCAGCGGCGCCGCCTCGCAGGGCGCCTACGCGGCCGGCTGCGCGTACCAGGAC
GCGCTGGTGCACTACCGACAGGCAAGGGGGCTGGCGGCGCAGAGCCTCGACATCGGCGTCATGACGGACATCGGC
TACGTTGCCGAGCACGACAACGTCATGAAACATTATCGATCTTACGGAAAGCGGGTAACGGTGGGCGAGCAAGAG
TTCCTTCATACCCTCCGCTGCGCGCTGGCCGGTACCGCTGACGGCGAGAGCCCGCTAACCCGGCAGCTCCTCCTC
GGGGCCGGCACCGGCGGCTTGGAGCAGCTGCGGCGGAAGGAGGTGCCGGACGTCGAATTCCCCTGGCTGCGGCAC
GGGGCGTCGTTGGCCTACCTGCGGCAGCTGGACATAGAGGTGACGGACACGCCGGAGAGACAAGATGATGCCTGC
GACCAGCCGCTGCAGCGGTTGCGGCAGGCCAGGTCGGCCGAGGAGGCGGCCGAGGCGGTGCAGGACGTGCTGCTG
GCGCGCATCGCCACGACGATGGCGGTGCCCGTGGCGGACATCGACGCGGCCAAGCCGCTGCGCGCGTACGGCATC
GACAGCTTAGTTGCCGTCGAGCTGCGCAACTGGCTGCACGCGAAGGTCCGGACCGACGTGCCAGTTCTGGCCCTG
ACGGGCAACACATCCATCAGCGCCCTCAGCAGGAGCATCGCAAGCAGGTCGCAGCTCGTGCCGGACGCGGCCAAG
GGGGGTCAGGCGGAGCCGCGCGACGGTCAGAAGACGCAGCAAGCGGATGGGATCCCGGCGAAAGCGAATCGAGTC
CCGGCGAAAGCGAACGGAATCCCAGCGCAGCAGTGA
Gene >Hirsu2|6729
ATGGCCGTCGGCCTGTCCGCCGACGGGGCGCGTCCGCACCTGGACGCCGCCGCCGGCCCCTTGACGCTGGCCTGC
GTCAACAGCCCCGAAAACGTGACACTGGCGGGCGACCGCTCCGCCCTCGAGGGCCTGGCCGAGAGGCTGAAGCGG
CAGGGCGTCTTCTGCCGCATGCTGCAGGTGAAGAACGCTTTCCATGGTCCGCAGATGTTGAGCGTCGGCGACGAG
TACCGCGGGCGCCTCGGCGACATGGCCGCCAATGACGTCTCGTCGACGACGTCGTTCTATTCGACCGTCCACGGC
ATCCGGGTGCCCCCGTCGACGCTCACGGCCGACTACTGGGTGGAGAATCTATGCTCGCCCGTCCAGCTCGTCGCC
GCCCTCGACAGCATCTTCTGCCCCGGCGACGGCAGTCCCCAGACGCCCACCGTCGTCCTCGAGCTCGGCGCCCAC
AGCGCCCTCGCCGGGCCCTTCAAGCAGTTCAAGCTCGCCCGCGGCGGCCTGAAGCACGTCACCTACCAGAGCCTC
CTCTCGCGGGGCCAGGACGCGATGCGCACCGCCCTGGGCGCGGCCGCCTCGCTGTGGGAGAGGGGCGTCGACGTC
GACATCAAACGGGTGAGCCCCCCCCCCCCCCCCCCCCCTTCTCTTCCCCTCTCCGGCTCTCCGGCTCTCCGGCTC
TCCGGCTCTCCGGCTCTCCGGCTCTCTCGCAGCATGTCTGCCTCCCCTCGGGTCGTTCCATCTGCTGACGGGCCG
GCCGCGAGCCAGATCAACGAGCCGTCATCGTCGACGCCGCCCGCCGTCCTCACCGACCTGCCGGCCTACTGCTGG
AACCACTCGACCTCGTACTGGCACGAGTCGCGCCAGTCCAGAAATCACCGCTCGCCGCCGGCCGCCAGGCACGAC
CTCATCGGGTCGCGCCTGGACGCGTGCAACCCGCTGGAGCCCGTGTGGCAGAACTACCTGCGGCTCGCGGAGCTG
CCCTGGCTCAGGGACCACCGGGTCCAGGGCGCCATCGTCTTCCCCGCGGCCGGCGTCGTGAGCGCCGTCGTCGAG
GCCGTGCGCCAGCTCGAGGCCGGCAACGCGGACCCCCTGACCGGCGTCGAGCTGCGCGAGTTCCGCATGCTGCAG
GCCCTCGTCATCCCCGACGCCGCCGACGCCGTCGAAGTCTCCCTCCACCTCAAGCGGAGGAAGCTGGGCATGGGC
AGCGGCGCCGGCGGCTGGCTCGAGTTCTCCTTCTACTCGTGCCAGGACGGCGACGCCTTCGTCGAGCACGCCTGC
GGGCTCGTCCAGGCCCAGCTCGCGACGCCGCCCGCCGAGCTGGACGGCGGCAGGGAGCAGCGCGAGGAGGCCAGC
GTCTTCCGGGAGCGCTGGAGAGGGACCGGCGGCTCGCCCGGGCGCGAGAAGCTGACGGGCCGGGAGCACTATGAC
TTCTTCGACAGCATCGGCCTCCAATACGGTAAGTCAGCACAGCACGGGCGGCGGCTGCAGCCCGCGGCGACCCGA
GAGAGTGCAGGGCCGAGCTGAACGGTACGGATAGGCAAAAGCTTCCAGGCCATCACCGGGGCCCGCCTTTTCGAG
CCCGTCGCGGCCTCGCCCCCCGCCACGCCCGGCTCTCTCTCGTCGGCCATGGCCTTTGAGGCGACCGTCGTGGAC
ACGCGCTCCGACATGCCGGGCTCGTGCGAGAGCGAGTACCTCATCCACCCGACGACGCTCGACTCGATTTGGCAG
GCGACTATGGGCAATCTCCTCCTCATGGACCGTTCGCAGAGGCAGACCTGGGTCGCCGCCGGCGCCGGGACGATC
AAAGTCTCGACCGCCATCGCCCGTGATCCCGGGGCCGCGCTGTATGGCATCTGCGATGCTGTCGTCAGCCCGGGC
GGGCAGACGAGGAGCTCCGTCTTCGTCGGCGACGGCACCTTCGACGCCTATCCTTGGCTCGTCATGGAGCATGTC
AGGGCTTCCAGGCTAGGGGCGTCGGAGAACGCGCCCGAGCCGCCGGAGGAAACGAAGAACAGGACGTGCGCGGCG
CCCGTCTGGAAGCCGGACCCGGATCTTGCCCCGGCGGCGGTCCTGCTGGGCCGGACCGAGGCCGACGACGAAACA
GACGCCCGCTTCATCTCCGATAACGCCGGCCTCGTCCGCGAGCTGTGCCGGATCGCCTTGAGAAGATTGAAGAAG
CTCAGGCTCGATGCTGATGGGCTGCCGTCCCACCTGCGCAAGTACGTCGAGTGGATGCGGGAGCAGAGCAGGACG
CCGGCGGCCGGCGACGCGACGACGCCTGCGGGAAGCCCCATCAGCCGCCGCGACGAGGCCGGGGAGGAGGAGGAG
GAGGAGGAGGAGGAGCGCCGGGCCATGGAGAAGCTGGAGGACCTCACCCAGAAGCACCCCGCCGACGGACAGCTG
ATGCGCCACGTCTTCGCGTCGCTGGACGACATCGTCGCCGAGCGAGTGATGGCCATGGAGCACCTCACGGCCAAC
GACTACCTCTCGACATACTACAAAGATTCCTTCGGATTAAGAAAAACACAAAGGTGCCTATGCCGCTGGTTCGAT
ATCAAGGCGCACAAGACGCCGGCCCTGCGCATCCTCGAGGTCGGTGCCGGGACGGGGTCGGTAACGGTGCCCATC
CTGGAGCAGCTGGCATTCGAGGACGGCGACACGCCTCGCTTCTCCACCTGGACCTTCACCGACATCTCGGCCGGC
TGGCTCGAAAAGGCCAAGGTACTGTTGCGCAAGCACGAGCCCCGCGTCGAGTTCAAGGGCCTGGACATCGAGGTC
GACCCCGTCGAGCAGGGCTTCGAGGCCGAGTCGTACGACGTCGTCTTCGCCGTCAACGTCTTCCACGCCACCCGC
GACCTGCGGAAAACGCTCGAAAATTGCAGGCGCCTGCTGAAGCCCGGCGGGAGCCTAGTCTTTGCCGAGATCTCG
GCCCGGGACGTCTTCAGCCGCTTCATCTTCGGGATCCTGCCTAGCTGGTGGTCGGCCGAGGACCGGCGGAGCGAC
AGCCCACTGCTCCGCGAGGCCGATTGGGACGAGGTCCTCAGGTCGGCCGGCTTCTCCGGGAACGAGGTCGTTCGG
CCCGACAGCTTGGACGTCTCTAGGTTCCCGATCGTGATCAGCACCAATACGCTCGGGCGGAACGTGGCCTCGGCC
AAGGACGTCGTCGTCGTCCTGCCCGACGACAAGACGGACCCAACGGCCGCGCTCGCGTTCGCCGTCTGCCGCGAG
CTCGGGCGCCTCGGCGCGCGCACGGCCGTCGTCAAGGACCTCGCGGCGGCGGCGGACGCCGTCGACAAGGGCAAG
ACGGTCGTCTCCCTCCTCGAGTACGAGAGGCCCTTCCTCGAGGCCGTCTCGGAGGACGGCTTCGAGCGGGCCAAG
CACCTCCTCCTCCACTGCGGCGAGCTCCTCTGGGTCACCAGGTCCGATGCCGCCGACGGCGTCGGCCACCCGAGC
ATGCGCACCATCTCCGGGCTCTTGTGCTGCATCAAGGCCGAGGACCCGGCCGCCGGGCTCCACGAGCTGCACTTT
TGCCGGCATCTCGCCGGCGGCATCGAGTCGGCCGGCGACATCATCGGCCGGCGGCTTATCAGCATCTGGCGCGAC
GGCGACGGCGACGGCGACGTGACGGAGACGACGGAGCGAGACGGGCACTTCTGCATCCAACGTTGGATGCCGGAC
AAGGCGATGAACGACAGCCTCGCGCGGGCCACCGGGGCGGACGCCGAGCCGCGCCAGGCCCGCCTCGTCCAGCCC
GGCCGGCCGCTGAAGCTGGCGGTCGGGCAGCCCGGCATGCTGGACACGCTCCACTGGGTCGACGACCCCGTCCCC
TCGCAGCCCTTGGCCGAGGACGAGGTCGAGATCGAGGCGCGGGTGTTGAGCCCCAACTTCCGGTCAGTGCTCGCC
CGGCAGCCGCCGCCCCTTCTTGTCCCGTCCTTTTCCGCGACGGAATGCCGAGCTGACGACGCGCAGGGACATCAT
GATCGCCATGGGCCAGCTGGAAGCGGCCGGCTTGGGCGTCGAGGCGGCCGGCATCGTCCGCCGCGTGGGCCCCGG
CGTCACCAAGGTTTCCCCGGGCGACCGCGTCGCGTGCTTTACGGATGCCGTCTTCCGGACCGACCCCCGAGCCCG
AGAGCCGTACGTCATGGCCTTGCCGCCGTCCTTGTCCCTCGAGGAGGGCGCTGCGACCCTGGCGTCCTATGGGAC
GGCGCACTGGTGCCTGGTCGAGGTCGGCCGGCTGCAGAAGGGAGAGTCGGTGCTCATCCACGCCGGGGCCGGAGG
TGAGAGGCCCGCCCCAGATTCCCCGTGACCAAGGCTGACTCGCAGTCCCCGGCCGCAGCCCTCGGCCAGGCCGCC
ATCCAGGTGGCGACGATGCTGGGGGCCGAAATCTACTGCACCGCGAGCACCGAGGCGAAGAAGCGCACAATGACG
TCCCTGGGCGTAAGGCCCGACCACATATTCAGCTCGCGCGACTTGTCGTTCGAAAAGGGCATCATGCGCAAGACG
AATGGCCGGGGCGTCGACGTAGTCGTCAACTCGCTGGCGGGTGAGGCGCTGCGCAAGAGCTGGGCTTGCATCGCG
CCCTTTGGCCGCTTCGTCGAGGTCGGCAAGAGGGACGCTGTAGCCAATACTGGGCTCGATATGGAGCCCTTTTTA
AGGGGTGCCGCGTTTGTCTTGGTTGATGCACTACAGGTGTCGACCTGTCAGCCAAAGGCGTGGGAGAGGACGATG
GAAACGGTGATGAAGCTGCTCGGCCAAGGCAGCGTCGGCCTGATCCAGCCCATCACAGTGCACGATGTATCCGAC
GCCGTGTCCGTCTTCCGTCAGATGCAGCAGGGGGGCCACACGGGCAAGCTGGTGCTCCGCGTCACGCCCGAGTCG
CTCGTACCCGTGACGCCGCGCAGGCTGGCCCCCCTCAGCCTCCGGCCGGACGCCAGCTACCTACTGGTCGGCGGC
CTCGGCGGTCTCGGCCGGGCCCAGGCGGTCTTCATGGCCGAGCGCGGCGCCCGCCATCTCGCCTTCGTCTCGCGC
TCCGGCGCCGCATCGGCCACAGCCCGAGACGTGCTCGCGAAGCTGGCCGAGGCCGGCGTCAACGCCAGGGCGTAC
GCCGGCGACGTCGCGGACAAGGACCGGCTGAGGGAGATACTCGCCGATATATCCCGAAGCATGCCGCCGATGCGG
GGCGTGATACATGGCGCCATGGCGCTCGACGATGTCCTGTTCCACAGTATGAGCCATGGCCAATGGGTCTATGCG
ACCCGGCCCAAGATCCAAGGTGGGTGGGCGCGGTAGGAGACGGGACGGACCGGGGTGGGACCCCCCCCTGCTGAC
CCTGGGCGCGCAGGAAGCTGGAACCTGCACGAGCTGCTCCCCGGGACGCTCGACTTCTTCGTGGTGCTGGCTTCA
AGAGTTGGCGTCAGCGGCGCCGCCTCGCAGGGCGCCTACGCGGCCGGCTGCGCGTACCAGGACGCGCTGGTGCAC
TACCGACAGGCAAGGGGGCTGGCGGCGCAGAGCCTCGACATCGGCGTCATGACGGACATCGGCTACGTTGCCGAG
CACGACAACGTCATGAAACATTATCGATCTTACGGAAAGGTACGGCCCAAAAAAGAGAGGAGGCATTTTTCCCCA
TTCCCCTTCGTCCGCTAACGAGAAGCCGATAGCGGGTAACGGTGGGCGAGCAAGAGTTCCTTCATACCCTCCGCT
GCGCGCTGGCCGGTACCGCTGACGGCGAGAGCCCGCTAACCCGGCAGCTCCTCCTCGGGGCCGGCACCGGCGGCT
TGGAGCAGCTGCGGCGGAAGGAGGTGCCGGACGTCGAATTCCCCTGGCTGCGGCACGGGGCGTCGTTGGCCTACC
TGCGGCAGCTGGACATAGAGGTGACGGACACGCCGGAGAGACAAGATGATGCCTGCGACCAGCCGCTGCAGCGGT
TGCGGCAGGCCAGGTCGGCCGAGGAGGCGGCCGAGGCGGTGCAGGACGTGCTGCTGGCGCGCATCGCCACGACGA
TGGCGGTGCCCGTGGCGGACATCGACGCGGCCAAGCCGCTGCGCGCGTACGGCATCGACAGCTTAGTTGCCGTCG
AGCTGCGCAACTGGCTGCACGCGAAGGTCCGGACCGACGTGCCAGTTCTGGCCCTGACGGGCAACACATCCATCA
GCGCCCTCAGCAGGAGCATCGCAAGCAGGTCGCAGCTCGTGCCGGACGCGGCCAAGGGGGGTCAGGCGGAGCCGC
GCGACGGTCAGAAGACGCAGCAAGCGGATGGGATCCCGGCGAAAGCGAATCGAGTCCCGGCGAAAGCGAACGGAA
TCCCAGCGCAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail