Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6728
Gene name
LocationContig_356:17426..18040
Strand-
Gene length (bp)614
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family 1.2E-30 29 141

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14105|RPE_SCHPO Ribulose-phosphate 3-epimerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.05c PE=3 SV=1 4 157 4.0E-42
sp|Q9SE42|RPE1_ORYSJ Ribulose-phosphate 3-epimerase, cytoplasmic isoform OS=Oryza sativa subsp. japonica GN=Os09g0505700 PE=1 SV=1 4 163 6.0E-42
sp|P46969|RPE_YEAST Ribulose-phosphate 3-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPE1 PE=1 SV=1 2 160 8.0E-38
sp|Q6FL81|RPE_CANGA Ribulose-phosphate 3-epimerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPE1 PE=3 SV=1 2 160 3.0E-37
sp|Q755M2|RPE_ASHGO Ribulose-phosphate 3-epimerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPE1 PE=3 SV=1 1 157 4.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14105|RPE_SCHPO Ribulose-phosphate 3-epimerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.05c PE=3 SV=1 4 157 4.0E-42
sp|Q9SE42|RPE1_ORYSJ Ribulose-phosphate 3-epimerase, cytoplasmic isoform OS=Oryza sativa subsp. japonica GN=Os09g0505700 PE=1 SV=1 4 163 6.0E-42
sp|P46969|RPE_YEAST Ribulose-phosphate 3-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPE1 PE=1 SV=1 2 160 8.0E-38
sp|Q6FL81|RPE_CANGA Ribulose-phosphate 3-epimerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPE1 PE=3 SV=1 2 160 3.0E-37
sp|Q755M2|RPE_ASHGO Ribulose-phosphate 3-epimerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPE1 PE=3 SV=1 1 157 4.0E-37
sp|Q96AT9|RPE_HUMAN Ribulose-phosphate 3-epimerase OS=Homo sapiens GN=RPE PE=1 SV=1 5 155 4.0E-34
sp|Q5R5Y2|RPE_PONAB Ribulose-phosphate 3-epimerase OS=Pongo abelii GN=RPE PE=2 SV=1 5 155 5.0E-34
sp|Q8VEE0|RPE_MOUSE Ribulose-phosphate 3-epimerase OS=Mus musculus GN=Rpe PE=1 SV=1 5 155 4.0E-33
sp|Q2QD12|RPEL1_HUMAN Ribulose-phosphate 3-epimerase-like protein 1 OS=Homo sapiens GN=RPEL1 PE=2 SV=1 5 155 6.0E-29
sp|Q9L0Z5|RPE_STRCO Ribulose-phosphate 3-epimerase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpe PE=3 SV=1 2 158 6.0E-28
sp|O34557|RPE_BACSU Ribulose-phosphate 3-epimerase OS=Bacillus subtilis (strain 168) GN=rpe PE=3 SV=1 2 156 7.0E-24
sp|Q43843|RPE_SOLTU Ribulose-phosphate 3-epimerase, chloroplastic (Fragment) OS=Solanum tuberosum PE=1 SV=1 2 156 6.0E-23
sp|Q43157|RPE_SPIOL Ribulose-phosphate 3-epimerase, chloroplastic OS=Spinacia oleracea GN=RPE PE=1 SV=1 2 156 7.0E-23
sp|P74061|RPE_SYNY3 Ribulose-phosphate 3-epimerase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpe PE=1 SV=3 2 156 1.0E-22
sp|Q9ZTP5|RPE_ORYSJ Ribulose-phosphate 3-epimerase, chloroplastic OS=Oryza sativa subsp. japonica GN=RPE PE=1 SV=2 2 156 2.0E-22
sp|P9WI51|RPE_MYCTU Ribulose-phosphate 3-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpe PE=1 SV=1 2 155 8.0E-19
sp|P9WI50|RPE_MYCTO Ribulose-phosphate 3-epimerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpe PE=3 SV=1 2 155 8.0E-19
sp|P65761|RPE_MYCBO Ribulose-phosphate 3-epimerase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpe PE=3 SV=1 2 155 8.0E-19
sp|P51013|RPE_RHORU Ribulose-phosphate 3-epimerase OS=Rhodospirillum rubrum GN=cbbE PE=3 SV=2 2 163 9.0E-19
sp|Q8K940|RPE_BUCAP Ribulose-phosphate 3-epimerase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpe PE=3 SV=1 2 145 9.0E-19
sp|P57603|RPE_BUCAI Ribulose-phosphate 3-epimerase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpe PE=3 SV=1 2 163 2.0E-18
sp|P56188|RPE_HELPY Ribulose-phosphate 3-epimerase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpe PE=3 SV=1 29 155 6.0E-18
sp|Q9ZJ75|RPE_HELPJ Ribulose-phosphate 3-epimerase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpe PE=3 SV=1 29 155 6.0E-18
sp|P44756|RPE_HAEIN Ribulose-phosphate 3-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpe PE=3 SV=1 2 157 1.0E-17
sp|Q89A59|RPE_BUCBP Ribulose-phosphate 3-epimerase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpe PE=3 SV=1 30 163 2.0E-17
sp|Q04539|RPEP_CUPNH Ribulose-phosphate 3-epimerase, plasmid OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbEP PE=3 SV=1 1 145 4.0E-17
sp|Q9CCP9|RPE_MYCLE Ribulose-phosphate 3-epimerase OS=Mycobacterium leprae (strain TN) GN=rpe PE=3 SV=1 29 142 4.0E-17
sp|P0AG10|RPE_SHIFL Ribulose-phosphate 3-epimerase OS=Shigella flexneri GN=rpe PE=3 SV=1 2 157 6.0E-17
sp|P0AG07|RPE_ECOLI Ribulose-phosphate 3-epimerase OS=Escherichia coli (strain K12) GN=rpe PE=1 SV=1 2 157 6.0E-17
sp|P0AG08|RPE_ECOL6 Ribulose-phosphate 3-epimerase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpe PE=3 SV=1 2 157 6.0E-17
sp|P0AG09|RPE_ECO57 Ribulose-phosphate 3-epimerase OS=Escherichia coli O157:H7 GN=rpe PE=3 SV=1 2 157 6.0E-17
sp|O66107|RPE_TREPA Ribulose-phosphate 3-epimerase OS=Treponema pallidum (strain Nichols) GN=rpe PE=3 SV=1 2 141 2.0E-16
sp|P45455|RPE_SERMA Ribulose-phosphate 3-epimerase OS=Serratia marcescens GN=rpe PE=3 SV=1 2 145 2.0E-16
sp|P40117|RPEC_CUPNH Ribulose-phosphate 3-epimerase, chromosomal OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbEC PE=3 SV=1 1 145 6.0E-16
sp|O67098|RPE_AQUAE Ribulose-phosphate 3-epimerase OS=Aquifex aeolicus (strain VF5) GN=rpe PE=3 SV=1 41 145 9.0E-16
sp|O84123|RPE_CHLTR Ribulose-phosphate 3-epimerase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpe PE=3 SV=1 2 141 1.0E-15
sp|P51012|RPE_RHOCA Ribulose-phosphate 3-epimerase OS=Rhodobacter capsulatus GN=cbbE PE=3 SV=2 26 141 2.0E-15
sp|Q9PKR7|RPE_CHLMU Ribulose-phosphate 3-epimerase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpe PE=3 SV=1 2 141 3.0E-15
sp|Q9Z8Z9|RPE_CHLPN Ribulose-phosphate 3-epimerase OS=Chlamydia pneumoniae GN=rpe PE=3 SV=1 1 143 6.0E-14
sp|Q58093|RPE_METJA Ribulose-phosphate 3-epimerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpe PE=3 SV=1 30 156 3.0E-13
sp|Q8SRP6|RPE_ENCCU Ribulose-phosphate 3-epimerase OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPE1 PE=3 SV=1 41 145 4.0E-12
sp|P32719|ALSE_ECOLI D-allulose-6-phosphate 3-epimerase OS=Escherichia coli (strain K12) GN=alsE PE=1 SV=1 38 150 3.0E-09
sp|P39362|SGCE_ECOLI Protein SgcE OS=Escherichia coli (strain K12) GN=sgcE PE=3 SV=1 29 145 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016857 racemase and epimerase activity, acting on carbohydrates and derivatives Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0016853 isomerase activity No
GO:0008150 biological_process No
GO:0016854 racemase and epimerase activity No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6728
LFKEAGCDLYCFHYEAAFSSAAESPEQSAEGTTSPRELIRYIHRTGMLAGIAIRPDTSVDVLWDILEADDPLDKP
DMVLVMTVMPGFGGQKFMASELPKVQQLRKRYPDLSIEVDGGLGPATIDQAADAGANVIVAGSAVFGAKDPAEAI
AALRKSVDQRNGRL*
Coding >Hirsu2|6728
CTGTTCAAGGAGGCCGGCTGCGACCTCTACTGCTTCCACTACGAGGCCGCCTTCTCCTCCGCCGCCGAGAGCCCC
GAGCAGAGCGCGGAGGGCACGACGAGCCCGCGCGAGCTGATCCGCTACATCCACCGGACCGGCATGCTGGCCGGC
ATCGCCATCCGGCCCGACACCTCTGTCGATGTCCTGTGGGACATTCTCGAGGCCGACGACCCCCTGGACAAGCCC
GATATGGTGCTCGTCATGACCGTCATGCCCGGCTTCGGCGGCCAGAAGTTCATGGCGTCGGAGCTGCCCAAGGTG
CAGCAGCTGCGCAAGCGCTACCCGGACCTGAGCATCGAGGTCGACGGCGGCCTCGGCCCGGCCACCATCGACCAG
GCCGCCGACGCGGGCGCCAACGTCATCGTCGCCGGCAGCGCCGTCTTCGGCGCCAAGGACCCGGCCGAGGCCATC
GCCGCGCTGCGCAAGTCGGTCGACCAGAGGAACGGCCGGCTGTGA
Transcript >Hirsu2|6728
CTGTTCAAGGAGGCCGGCTGCGACCTCTACTGCTTCCACTACGAGGCCGCCTTCTCCTCCGCCGCCGAGAGCCCC
GAGCAGAGCGCGGAGGGCACGACGAGCCCGCGCGAGCTGATCCGCTACATCCACCGGACCGGCATGCTGGCCGGC
ATCGCCATCCGGCCCGACACCTCTGTCGATGTCCTGTGGGACATTCTCGAGGCCGACGACCCCCTGGACAAGCCC
GATATGGTGCTCGTCATGACCGTCATGCCCGGCTTCGGCGGCCAGAAGTTCATGGCGTCGGAGCTGCCCAAGGTG
CAGCAGCTGCGCAAGCGCTACCCGGACCTGAGCATCGAGGTCGACGGCGGCCTCGGCCCGGCCACCATCGACCAG
GCCGCCGACGCGGGCGCCAACGTCATCGTCGCCGGCAGCGCCGTCTTCGGCGCCAAGGACCCGGCCGAGGCCATC
GCCGCGCTGCGCAAGTCGGTCGACCAGAGGAACGGCCGGCTGTGA
Gene >Hirsu2|6728
CTGTTCAAGGAGGCCGGCTGCGACCTCTACTGCTTCCACTACGAGGCCGCCTTCTCCTCCGCCGCCGAGAGCCCC
GAGCAGAGCGCGGAGGGCACGACGAGCCCGCGCGAGCTGATCCGCTACATCCACCGGACCGGCATGCTGGCCGGC
ATCGCCATCCGGCCCGACACCTCTGTCGATGTCCTGTGGGACATTCTCGAGGCCGACGACCCCCTGGACAAGCCC
GATGTAAAAGAGAAGCTCCCCCCCCCCCTCTTCCCCCCCCTTTGCTACACCCACCCACCCACCCACACACACACA
CACATACCCCTTCCTTGTCCGCCAGAGAGCTGACGGCGCGGCCGCAGATGGTGCTCGTCATGACCGTCATGCCCG
GCTTCGGCGGCCAGAAGTTCATGGCGTCGGAGCTGCCCAAGGTGCAGCAGCTGCGCAAGCGCTACCCGGACCTGA
GCATCGAGGTCGACGGCGGCCTCGGCCCGGCCACCATCGACCAGGCCGCCGACGCGGGCGCCAACGTCATCGTCG
CCGGCAGCGCCGTCTTCGGCGCCAAGGACCCGGCCGAGGCCATCGCCGCGCTGCGCAAGTCGGTCGACCAGAGGA
ACGGCCGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail