Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6727
Gene name
LocationContig_356:14109..16309
Strand-
Gene length (bp)2200
Transcript length (bp)2058
Coding sequence length (bp)2058
Protein length (aa) 686

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10637 Ofd1_CTDD Oxoglutarate and iron-dependent oxygenase degradation C-term 1.2E-86 341 656
PF13661 2OG-FeII_Oxy_4 2OG-Fe(II) oxygenase superfamily 1.3E-21 150 247
PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily 1.3E-10 151 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q11120|OFD1_SCHPO Prolyl 3,4-dihydroxylase ofd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ofd1 PE=1 SV=1 33 528 6.0E-117
sp|P40032|TPA1_YEAST Prolyl 3,4-dihydroxylase TPA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPA1 PE=1 SV=1 1 661 5.0E-104
sp|Q01F03|OGFD1_OSTTA Prolyl 3,4-dihydroxylase OGFOD1 OS=Ostreococcus tauri GN=Ogd PE=1 SV=1 57 526 1.0E-59
sp|Q8N543|OGFD1_HUMAN Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens GN=OGFOD1 PE=1 SV=1 57 649 1.0E-21
sp|Q5R4R3|OGFD1_PONAB Prolyl 3-hydroxylase OGFOD1 OS=Pongo abelii GN=OGFOD1 PE=2 SV=1 57 649 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q11120|OFD1_SCHPO Prolyl 3,4-dihydroxylase ofd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ofd1 PE=1 SV=1 33 528 6.0E-117
sp|P40032|TPA1_YEAST Prolyl 3,4-dihydroxylase TPA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPA1 PE=1 SV=1 1 661 5.0E-104
sp|Q01F03|OGFD1_OSTTA Prolyl 3,4-dihydroxylase OGFOD1 OS=Ostreococcus tauri GN=Ogd PE=1 SV=1 57 526 1.0E-59
sp|Q8N543|OGFD1_HUMAN Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens GN=OGFOD1 PE=1 SV=1 57 649 1.0E-21
sp|Q5R4R3|OGFD1_PONAB Prolyl 3-hydroxylase OGFOD1 OS=Pongo abelii GN=OGFOD1 PE=2 SV=1 57 649 2.0E-21
sp|Q6DE73|OGFD1_XENLA Prolyl 3-hydroxylase OGFOD1 OS=Xenopus laevis GN=ogfod1 PE=2 SV=1 1 411 1.0E-20
sp|Q3MI03|OGFD1_BOVIN Prolyl 3-hydroxylase OGFOD1 OS=Bos taurus GN=OGFOD1 PE=2 SV=2 57 383 1.0E-19
sp|Q3U0K8|OGFD1_MOUSE Prolyl 3-hydroxylase OGFOD1 OS=Mus musculus GN=Ogfod1 PE=1 SV=1 1 383 2.0E-18
sp|Q9I7H9|OGFD1_DROME Prolyl 3-hydroxylase sudestada1 OS=Drosophila melanogaster GN=sud1 PE=2 SV=1 46 284 3.0E-13
sp|Q11120|OFD1_SCHPO Prolyl 3,4-dihydroxylase ofd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ofd1 PE=1 SV=1 571 650 7.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016706 2-oxoglutarate-dependent dioxygenase activity Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0031418 L-ascorbic acid binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0050662 coenzyme binding No
GO:0051213 dioxygenase activity No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0048037 cofactor binding No
GO:0030246 carbohydrate binding No
GO:0046914 transition metal ion binding No
GO:0031406 carboxylic acid binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0048029 monosaccharide binding No
GO:0019842 vitamin binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0043177 organic acid binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6727
MKRKAESSAGPSGKQASSKRTKTSPLSAHEAKERFRPGLFDKSVLEAYTAEYGASAPYKHGVIDELVDDGLLRSV
RDEIRRNVHFTPKETDIYKIHQSGDLANLDGLDDASLAKLPSLLALRDAVYSDAFRRYVAAITGCGPLSGRKTDM
AINVYTPGCYLLCHDDVIGSRRVSYILYLTDPDRPWKPEWGGALRLFPVRQLGGRDGGALARTPLPDPVKVIPPA
WNQLSFFAVQPGESFHDVEEVYHAAAAAADDDDDDDDDNEGAAAAAAPRVRMAISGWFHIPQPGEDGYVEGEEAR
NAENSSLMQLQGDPAQYDAPRPRPARVERPGASQDDFDAADLEFLLKYMAPTYLTPDTLEQMARHFGDNSSITLA
HILSAKFARRLRDHLEAEERRPLPDGGSAAIEKASPWRVARPPHKHRYLYQQPAAPDQLRTSQDESPVSELLDTL
LPSRPFRHWLQLATGCTVESCDVVARRFRRGMDYTLATGHDGKPRLELNLGITPTSGWGDDDDDDDEDDEQGDEQ
DDSDDQARRKAKGKAKARANKAAKGKAKAGAEDAKPDRDRPAVDDDDDVGGHEVYMAGDDDDAAAGQDAAVYRSA
AADDDNVLFFQAAAWNKMSIVLRDRGALRFVKYVSRRAPGDRWDVSAVFDVEDEDADADDAPVPLGQSDEDEFQG
FSDSVDSESD*
Coding >Hirsu2|6727
ATGAAGAGAAAGGCCGAGAGCTCGGCTGGCCCCAGCGGCAAGCAGGCCAGCAGCAAGCGGACCAAGACCTCTCCG
CTGTCTGCGCACGAGGCCAAGGAGCGCTTCCGGCCCGGCCTGTTCGACAAGTCGGTGCTGGAGGCGTACACGGCC
GAGTACGGCGCGTCGGCGCCGTACAAGCACGGCGTCATCGACGAGCTCGTCGACGACGGCCTGCTGCGCTCCGTG
CGCGACGAGATCCGCCGCAACGTCCACTTCACGCCCAAGGAGACGGACATCTACAAGATCCACCAGTCGGGCGAC
CTGGCCAACCTCGACGGGCTCGACGACGCCTCGCTCGCCAAGCTGCCCTCGCTGCTGGCGCTGCGCGACGCCGTC
TACTCCGACGCCTTCCGCCGCTACGTCGCCGCCATCACCGGCTGCGGGCCCCTGAGCGGCCGCAAGACCGACATG
GCCATCAACGTCTACACCCCCGGCTGCTACCTCCTCTGCCACGACGACGTCATCGGCAGCCGCCGCGTCAGCTAC
ATCCTCTACCTGACCGACCCGGACCGGCCCTGGAAGCCCGAGTGGGGCGGCGCCCTCCGCCTCTTCCCCGTCCGC
CAGCTCGGCGGCCGCGACGGCGGCGCCCTGGCCCGGACGCCGCTGCCCGACCCCGTCAAGGTGATCCCGCCCGCC
TGGAACCAGCTCAGCTTCTTCGCCGTCCAGCCCGGCGAGAGCTTCCACGACGTCGAGGAGGTCTACCATGCCGCC
GCCGCCGCCGCCGACGACGACGACGACGACGACGACGACAACGAGGGCGCCGCCGCCGCCGCCGCCCCCCGCGTC
CGCATGGCCATCAGCGGCTGGTTCCACATCCCCCAGCCCGGCGAGGACGGCTACGTCGAGGGCGAGGAGGCCCGC
AACGCCGAGAACAGCAGCCTGATGCAGCTGCAGGGCGACCCCGCCCAGTACGACGCGCCGCGCCCGCGGCCGGCC
CGGGTCGAGCGGCCCGGCGCCAGCCAGGACGACTTCGACGCGGCCGACCTCGAGTTCCTGCTCAAGTACATGGCG
CCCACGTACCTGACGCCCGACACGCTGGAGCAGATGGCGCGCCACTTCGGCGACAACTCGAGCATCACGCTCGCG
CACATCCTGTCGGCCAAGTTCGCCCGCCGGCTGCGCGACCACCTGGAGGCCGAGGAGCGGCGGCCGCTGCCGGAC
GGCGGCAGCGCCGCCATCGAGAAGGCGTCGCCGTGGAGGGTGGCGCGCCCGCCGCACAAGCACCGCTACCTGTAC
CAGCAGCCCGCGGCCCCCGACCAGCTGCGCACGTCGCAGGACGAGAGCCCCGTCAGCGAGCTGCTCGACACCCTG
CTGCCCAGCCGCCCCTTCCGCCACTGGCTGCAGCTGGCCACGGGCTGCACCGTCGAGAGCTGCGACGTCGTCGCC
CGCCGCTTCCGCCGCGGCATGGACTACACCCTCGCCACCGGCCACGACGGCAAGCCCCGCCTGGAGCTCAACCTG
GGCATCACCCCGACCTCGGGCTGGGGCGACGACGACGACGACGACGACGAAGACGACGAGCAAGGGGACGAACAA
GACGATTCCGATGACCAGGCACGACGCAAGGCCAAGGGCAAGGCCAAAGCAAGGGCCAACAAGGCGGCCAAGGGC
AAGGCTAAAGCCGGGGCCGAGGACGCCAAGCCCGACAGGGACCGGCCCGCCGTCGATGACGACGACGACGTGGGC
GGCCACGAGGTGTACATGGCAGGCGACGACGACGACGCCGCCGCCGGCCAGGACGCCGCCGTCTACCGCTCCGCC
GCCGCCGACGACGACAACGTCCTCTTCTTCCAGGCCGCGGCCTGGAACAAGATGAGCATCGTGCTGCGCGACCGC
GGCGCCCTGCGCTTCGTCAAGTACGTCAGCCGCCGCGCCCCGGGCGACCGCTGGGACGTCTCGGCCGTCTTCGAC
GTCGAGGACGAGGACGCCGATGCCGACGACGCGCCCGTGCCCCTTGGCCAGTCGGACGAGGACGAGTTTCAAGGC
TTCTCCGACTCGGTCGACAGCGAGAGCGACTGA
Transcript >Hirsu2|6727
ATGAAGAGAAAGGCCGAGAGCTCGGCTGGCCCCAGCGGCAAGCAGGCCAGCAGCAAGCGGACCAAGACCTCTCCG
CTGTCTGCGCACGAGGCCAAGGAGCGCTTCCGGCCCGGCCTGTTCGACAAGTCGGTGCTGGAGGCGTACACGGCC
GAGTACGGCGCGTCGGCGCCGTACAAGCACGGCGTCATCGACGAGCTCGTCGACGACGGCCTGCTGCGCTCCGTG
CGCGACGAGATCCGCCGCAACGTCCACTTCACGCCCAAGGAGACGGACATCTACAAGATCCACCAGTCGGGCGAC
CTGGCCAACCTCGACGGGCTCGACGACGCCTCGCTCGCCAAGCTGCCCTCGCTGCTGGCGCTGCGCGACGCCGTC
TACTCCGACGCCTTCCGCCGCTACGTCGCCGCCATCACCGGCTGCGGGCCCCTGAGCGGCCGCAAGACCGACATG
GCCATCAACGTCTACACCCCCGGCTGCTACCTCCTCTGCCACGACGACGTCATCGGCAGCCGCCGCGTCAGCTAC
ATCCTCTACCTGACCGACCCGGACCGGCCCTGGAAGCCCGAGTGGGGCGGCGCCCTCCGCCTCTTCCCCGTCCGC
CAGCTCGGCGGCCGCGACGGCGGCGCCCTGGCCCGGACGCCGCTGCCCGACCCCGTCAAGGTGATCCCGCCCGCC
TGGAACCAGCTCAGCTTCTTCGCCGTCCAGCCCGGCGAGAGCTTCCACGACGTCGAGGAGGTCTACCATGCCGCC
GCCGCCGCCGCCGACGACGACGACGACGACGACGACGACAACGAGGGCGCCGCCGCCGCCGCCGCCCCCCGCGTC
CGCATGGCCATCAGCGGCTGGTTCCACATCCCCCAGCCCGGCGAGGACGGCTACGTCGAGGGCGAGGAGGCCCGC
AACGCCGAGAACAGCAGCCTGATGCAGCTGCAGGGCGACCCCGCCCAGTACGACGCGCCGCGCCCGCGGCCGGCC
CGGGTCGAGCGGCCCGGCGCCAGCCAGGACGACTTCGACGCGGCCGACCTCGAGTTCCTGCTCAAGTACATGGCG
CCCACGTACCTGACGCCCGACACGCTGGAGCAGATGGCGCGCCACTTCGGCGACAACTCGAGCATCACGCTCGCG
CACATCCTGTCGGCCAAGTTCGCCCGCCGGCTGCGCGACCACCTGGAGGCCGAGGAGCGGCGGCCGCTGCCGGAC
GGCGGCAGCGCCGCCATCGAGAAGGCGTCGCCGTGGAGGGTGGCGCGCCCGCCGCACAAGCACCGCTACCTGTAC
CAGCAGCCCGCGGCCCCCGACCAGCTGCGCACGTCGCAGGACGAGAGCCCCGTCAGCGAGCTGCTCGACACCCTG
CTGCCCAGCCGCCCCTTCCGCCACTGGCTGCAGCTGGCCACGGGCTGCACCGTCGAGAGCTGCGACGTCGTCGCC
CGCCGCTTCCGCCGCGGCATGGACTACACCCTCGCCACCGGCCACGACGGCAAGCCCCGCCTGGAGCTCAACCTG
GGCATCACCCCGACCTCGGGCTGGGGCGACGACGACGACGACGACGACGAAGACGACGAGCAAGGGGACGAACAA
GACGATTCCGATGACCAGGCACGACGCAAGGCCAAGGGCAAGGCCAAAGCAAGGGCCAACAAGGCGGCCAAGGGC
AAGGCTAAAGCCGGGGCCGAGGACGCCAAGCCCGACAGGGACCGGCCCGCCGTCGATGACGACGACGACGTGGGC
GGCCACGAGGTGTACATGGCAGGCGACGACGACGACGCCGCCGCCGGCCAGGACGCCGCCGTCTACCGCTCCGCC
GCCGCCGACGACGACAACGTCCTCTTCTTCCAGGCCGCGGCCTGGAACAAGATGAGCATCGTGCTGCGCGACCGC
GGCGCCCTGCGCTTCGTCAAGTACGTCAGCCGCCGCGCCCCGGGCGACCGCTGGGACGTCTCGGCCGTCTTCGAC
GTCGAGGACGAGGACGCCGATGCCGACGACGCGCCCGTGCCCCTTGGCCAGTCGGACGAGGACGAGTTTCAAGGC
TTCTCCGACTCGGTCGACAGCGAGAGCGACTGA
Gene >Hirsu2|6727
ATGAAGAGAAAGGCCGAGAGCTCGGCTGGCCCCAGCGGCAAGCAGGCCAGCAGCAAGCGGACCAAGACCTGTGCG
TCTGCCTCGTCCCCGTTTGCCAAGGCGGCCCGGGAGAGGAGGAGGGGAGGCCGACGCTGCATGCGCCGTGTTTTC
CTCGGCCGTCCCGTCCCCGTGCCGACCGGGGACAGACCATGTGGCTGACGTCGATTACCCAGCTCCGCTGTCTGC
GCACGAGGCCAAGGAGCGCTTCCGGCCCGGCCTGTTCGACAAGTCGGTGCTGGAGGCGTACACGGCCGAGTACGG
CGCGTCGGCGCCGTACAAGCACGGCGTCATCGACGAGCTCGTCGACGACGGCCTGCTGCGCTCCGTGCGCGACGA
GATCCGCCGCAACGTCCACTTCACGCCCAAGGAGACGGACATCTACAAGATCCACCAGTCGGGCGACCTGGCCAA
CCTCGACGGGCTCGACGACGCCTCGCTCGCCAAGCTGCCCTCGCTGCTGGCGCTGCGCGACGCCGTCTACTCCGA
CGCCTTCCGCCGCTACGTCGCCGCCATCACCGGCTGCGGGCCCCTGAGCGGCCGCAAGACCGACATGGCCATCAA
CGTCTACACCCCCGGCTGCTACCTCCTCTGCCACGACGACGTCATCGGCAGCCGCCGCGTCAGCTACATCCTCTA
CCTGACCGACCCGGACCGGCCCTGGAAGCCCGAGTGGGGCGGCGCCCTCCGCCTCTTCCCCGTCCGCCAGCTCGG
CGGCCGCGACGGCGGCGCCCTGGCCCGGACGCCGCTGCCCGACCCCGTCAAGGTGATCCCGCCCGCCTGGAACCA
GCTCAGCTTCTTCGCCGTCCAGCCCGGCGAGAGCTTCCACGACGTCGAGGAGGTCTACCATGCCGCCGCCGCCGC
CGCCGACGACGACGACGACGACGACGACGACAACGAGGGCGCCGCCGCCGCCGCCGCCCCCCGCGTCCGCATGGC
CATCAGCGGCTGGTTCCACATCCCCCAGCCCGGCGAGGACGGCTACGTCGAGGGCGAGGAGGCCCGCAACGCCGA
GAACAGCAGCCTGATGCAGCTGCAGGGCGACCCCGCCCAGTACGACGCGCCGCGCCCGCGGCCGGCCCGGGTCGA
GCGGCCCGGCGCCAGCCAGGACGACTTCGACGCGGCCGACCTCGAGTTCCTGCTCAAGTACATGGCGCCCACGTA
CCTGACGCCCGACACGCTGGAGCAGATGGCGCGCCACTTCGGCGACAACTCGAGCATCACGCTCGCGCACATCCT
GTCGGCCAAGTTCGCCCGCCGGCTGCGCGACCACCTGGAGGCCGAGGAGCGGCGGCCGCTGCCGGACGGCGGCAG
CGCCGCCATCGAGAAGGCGTCGCCGTGGAGGGTGGCGCGCCCGCCGCACAAGCACCGCTACCTGTACCAGCAGCC
CGCGGCCCCCGACCAGCTGCGCACGTCGCAGGACGAGAGCCCCGTCAGCGAGCTGCTCGACACCCTGCTGCCCAG
CCGCCCCTTCCGCCACTGGCTGCAGCTGGCCACGGGCTGCACCGTCGAGAGCTGCGACGTCGTCGCCCGCCGCTT
CCGCCGCGGCATGGACTACACCCTCGCCACCGGCCACGACGGCAAGCCCCGCCTGGAGCTCAACCTGGGCATCAC
CCCGACCTCGGGCTGGGGCGACGACGACGACGACGACGACGAAGACGACGAGCAAGGGGACGAACAAGACGATTC
CGATGACCAGGCACGACGCAAGGCCAAGGGCAAGGCCAAAGCAAGGGCCAACAAGGCGGCCAAGGGCAAGGCTAA
AGCCGGGGCCGAGGACGCCAAGCCCGACAGGGACCGGCCCGCCGTCGATGACGACGACGACGTGGGCGGCCACGA
GGTGTACATGGCAGGCGACGACGACGACGCCGCCGCCGGCCAGGACGCCGCCGTCTACCGCTCCGCCGCCGCCGA
CGACGACAACGTCCTCTTCTTCCAGGCCGCGGCCTGGAACAAGATGAGCATCGTGCTGCGCGACCGCGGCGCCCT
GCGCTTCGTCAAGTACGTCAGCCGCCGCGCCCCGGGCGACCGCTGGGACGTCTCGGCCGTCTTCGACGTCGAGGA
CGAGGACGCCGATGCCGACGACGCGCCCGTGCCCCTTGGCCAGTCGGACGAGGACGAGTTTCAAGGCTTCTCCGA
CTCGGTCGACAGCGAGAGCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail