Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6724
Gene name
LocationContig_356:598..1957
Strand-
Gene length (bp)1359
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.0E-28 52 344

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 6 343 3.0E-27
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 44 335 1.0E-24
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 2 202 8.0E-14
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 2 202 8.0E-14
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 63 220 9.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 6 343 3.0E-27
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 44 335 1.0E-24
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 2 202 8.0E-14
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 2 202 8.0E-14
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 63 220 9.0E-13
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 40 343 2.0E-12
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 45 343 1.0E-11
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 52 202 2.0E-11
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 37 202 7.0E-11
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 38 226 1.0E-10
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 38 226 1.0E-10
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 46 209 9.0E-10
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 37 202 1.0E-09
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 3 207 9.0E-09
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 49 212 5.0E-08
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 54 202 7.0E-07
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 38 202 1.0E-06
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 54 202 1.0E-06
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 37 202 2.0E-06
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 37 202 2.0E-06
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 67 221 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 81 103 22
3 110 129 19
4 139 161 22
5 168 190 22
6 200 222 22
7 290 308 18
8 318 337 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6724
MAVRTTERRPSSHRTSSNTSEKGEDDHGDGQGLKLPMSKAKCIALVATVTGAAFLNTLSIQSVVIILPTIGNELS
VPECRQQWIVSSYSLTFGCFLLFWGRVADIYGMRLIFILGSVWVTIVTAANPFMPHEVAFDLFRGLHGLGAAANV
PTAIGILGVTFPPGKAKNYAFSTYAVGAPLGNVFGNIVSGLIAEYSSWKWVFGASAIMAGAIAVAGIVFIPPRSK
MEAFETAAPRTAAPSPATATTTSQMDDDVAVTTPPAGGHGGGYDGLEPRRSPLPAIPPQPPSVDWIGAVLITTSL
TALMFALTEGNVVGWDTPWIPVIIVGSLLVIVAFVFWQRRLERLNRPDGGPP*
Coding >Hirsu2|6724
ATGGCAGTCAGGACGACGGAAAGGAGGCCGTCATCGCACCGCACCAGCTCGAACACGTCCGAGAAGGGCGAGGAT
GACCATGGTGACGGCCAGGGCCTGAAGCTGCCCATGTCCAAGGCGAAGTGCATCGCCCTGGTGGCCACGGTGACG
GGCGCCGCCTTTCTCAATACCCTTTCCATCCAGAGCGTCGTCATCATCCTGCCGACGATCGGCAATGAGCTGTCG
GTGCCCGAGTGTCGGCAACAGTGGATCGTCTCGTCGTACTCGCTCACCTTTGGCTGCTTTTTGCTCTTCTGGGGC
CGCGTCGCCGATATCTACGGCATGCGCCTCATCTTCATCCTCGGCTCCGTCTGGGTCACGATCGTGACGGCGGCA
AATCCCTTTATGCCGCATGAGGTTGCCTTCGACCTGTTTCGCGGTCTCCACGGCCTGGGTGCTGCGGCTAATGTC
CCCACGGCAATAGGCATCCTCGGCGTCACGTTCCCCCCCGGCAAGGCCAAGAACTACGCCTTCAGCACGTACGCC
GTCGGAGCGCCGCTCGGCAACGTCTTTGGCAACATCGTCTCGGGGCTCATAGCCGAGTACTCGAGCTGGAAATGG
GTCTTCGGCGCCTCTGCCATCATGGCGGGCGCGATTGCTGTGGCCGGCATCGTCTTCATCCCGCCGCGGTCCAAG
ATGGAAGCATTCGAGACGGCCGCCCCTCGGACCGCGGCTCCGAGCCCGGCAACAGCAACCACAACATCCCAGATG
GACGACGACGTGGCCGTCACCACTCCTCCCGCTGGTGGCCATGGCGGCGGTTATGACGGTCTTGAGCCCAGGCGC
TCTCCCCTCCCTGCCATCCCCCCGCAACCGCCGTCTGTCGACTGGATCGGCGCCGTCCTCATCACGACCAGCCTC
ACGGCTCTCATGTTTGCTCTGACCGAAGGCAACGTGGTCGGCTGGGACACTCCCTGGATCCCCGTCATCATCGTC
GGCTCCCTGCTCGTCATCGTCGCCTTCGTCTTCTGGCAGCGGCGCCTGGAGCGCCTCAACAGGCCGGACGGCGGC
CCGCCGTGA
Transcript >Hirsu2|6724
ATGGCAGTCAGGACGACGGAAAGGAGGCCGTCATCGCACCGCACCAGCTCGAACACGTCCGAGAAGGGCGAGGAT
GACCATGGTGACGGCCAGGGCCTGAAGCTGCCCATGTCCAAGGCGAAGTGCATCGCCCTGGTGGCCACGGTGACG
GGCGCCGCCTTTCTCAATACCCTTTCCATCCAGAGCGTCGTCATCATCCTGCCGACGATCGGCAATGAGCTGTCG
GTGCCCGAGTGTCGGCAACAGTGGATCGTCTCGTCGTACTCGCTCACCTTTGGCTGCTTTTTGCTCTTCTGGGGC
CGCGTCGCCGATATCTACGGCATGCGCCTCATCTTCATCCTCGGCTCCGTCTGGGTCACGATCGTGACGGCGGCA
AATCCCTTTATGCCGCATGAGGTTGCCTTCGACCTGTTTCGCGGTCTCCACGGCCTGGGTGCTGCGGCTAATGTC
CCCACGGCAATAGGCATCCTCGGCGTCACGTTCCCCCCCGGCAAGGCCAAGAACTACGCCTTCAGCACGTACGCC
GTCGGAGCGCCGCTCGGCAACGTCTTTGGCAACATCGTCTCGGGGCTCATAGCCGAGTACTCGAGCTGGAAATGG
GTCTTCGGCGCCTCTGCCATCATGGCGGGCGCGATTGCTGTGGCCGGCATCGTCTTCATCCCGCCGCGGTCCAAG
ATGGAAGCATTCGAGACGGCCGCCCCTCGGACCGCGGCTCCGAGCCCGGCAACAGCAACCACAACATCCCAGATG
GACGACGACGTGGCCGTCACCACTCCTCCCGCTGGTGGCCATGGCGGCGGTTATGACGGTCTTGAGCCCAGGCGC
TCTCCCCTCCCTGCCATCCCCCCGCAACCGCCGTCTGTCGACTGGATCGGCGCCGTCCTCATCACGACCAGCCTC
ACGGCTCTCATGTTTGCTCTGACCGAAGGCAACGTGGTCGGCTGGGACACTCCCTGGATCCCCGTCATCATCGTC
GGCTCCCTGCTCGTCATCGTCGCCTTCGTCTTCTGGCAGCGGCGCCTGGAGCGCCTCAACAGGCCGGACGGCGGC
CCGCCGTGA
Gene >Hirsu2|6724
ATGGCAGTCAGGACGACGGAAAGGAGGCCGTCATCGCACCGCACCAGCTCGAACACGTCCGAGAAGGGCGAGGAT
GACCATGGTGACGGCCAGGGCCTGAAGCTGCCCATGTCCAAGGCGAAGTGCATCGCCCTGGTGGCCACGGTGACG
GGCGCCGCCTTTCTCAATGTCAGTGCCCTCGCCTCTCTCCCGATCGGACCGAGGAACTGACGGCCGGTCTTTTGT
CCTCGAGCGCGCCTGCAGACCCTTTCCATCCAGAGCGTCGTCATCATCCTGCCGACGATCGGCAATGAGCTGTCG
GTGCCCGAGTGTCGGCAACAGTGGATCGTCTCGTCGTACTCGCTCACCTTTGGCTGCTTTTTGCTCTTCTGGGGC
CGCGTCGCCGATATCTACGGCATGCGCCTCATCTTCATCCTCGGCTCCGTCTGGGTCACGATCGTGACGGCGGCA
AATCCCTTTATGCCGCATGAGGTTGCCTTCGACCTGTTTCGCGGTCTCCACGGCCTGGTAGGATCACGTCTGTCG
ACTCGGGAGCGACCTGGCTGACTGGCTCGTCTGTAGGGTGCTGCGGCTAATGTCCCCACGGCAATAGGCATCCTC
GGCGTCACGTTCCCCCCCGGCAAGGCCAAGAACTACGCCTTCAGCACGTACGGTTCGTCTCCGCTGCTCTCCGCA
CTCAGGGCGAGCGCCCAGCGTTGTAACGTGGCGGTCTAGGCTGACGATTCAACCTGTCTGTTCCCGGTGCAGCCG
TCGGAGCGCCGCTCGGCAACGTCTTTGGCAACATCGTCTCGGGGCTCATAGCCGAGTACTCGAGCTGGAAATGGG
TCTTCGGCGCCTCTGCCATCATGGCGGGCGCGATTGCTGTGGCCGGCATCGTCTTCATCCCGCCGCGGTCCAAGA
TGGAAGCATTCGAGACGGCCGCCCCTCGGACCGCGGCTCCGAGCCCGGCAACAGCAACCACAACATCCCAGATGG
ACGACGACGTGGCCGTCACCACTCCTCCCGCTGGTGGCCATGGCGGCGGTTATGACGGTCTTGAGCCCAGGCGCT
CTCCCCTCCCTGCCATCCCCCCGCAACCGCCGTCTGTCGACTGGATCGGCGCCGTCCTCATCACGACCAGCCTCA
CGGCTCTCATGTTTGCTCTGACCGAAGGCAACGTGGTCGGCTGGGACACTCCCTGGATCCCCGTCATCATCGTCG
GCTCCCTGCTCGTCATCGTCGCCTTCGTCTTCTGGCAGCGGCGCCTGGAGCGCCTCAACAGGCCGGACGGCGGCC
GTGCCCGGCGCTCGCACCGGCTGCTCTCGCCGCCGCCCCTAATGAAGGTGTCCATCTTCGGCAACGTGCGCTTCA
GCGCCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail