Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6708
Gene name
LocationContig_353:8264..10637
Strand-
Gene length (bp)2373
Transcript length (bp)2259
Coding sequence length (bp)2259
Protein length (aa) 753

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 6.2E-36 14 432
PF06280 fn3_5 Fn3-like domain 1.4E-14 476 589

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 11 506 3.0E-30
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 10 208 8.0E-17
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 3 178 7.0E-15
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 1 194 1.0E-14
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 16 180 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 11 506 3.0E-30
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 10 208 8.0E-17
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 3 178 7.0E-15
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 1 194 1.0E-14
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 16 180 2.0E-14
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 3 178 2.0E-14
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 1 194 3.0E-14
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 1 194 3.0E-14
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 3 178 2.0E-13
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 3 178 2.0E-13
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 3 178 2.0E-13
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 14 172 4.0E-13
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 1 170 4.0E-12
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 1 170 4.0E-12
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 6 174 9.0E-11
sp|Q9SA75|SBT21_ARATH Subtilisin-like protease SBT2.1 OS=Arabidopsis thaliana GN=SBT2.1 PE=2 SV=1 14 492 1.0E-10
sp|P54423|WPRA_BACSU Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 19 197 3.0E-10
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 14 164 5.0E-10
sp|P80146|SEPR_THESR Extracellular serine proteinase OS=Thermus sp. (strain Rt41A) PE=1 SV=3 13 206 6.0E-10
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 8 178 2.0E-09
sp|P41363|ELYA_BACHD Thermostable alkaline protease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0855 PE=1 SV=2 6 191 8.0E-09
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 1 213 9.0E-09
sp|P28842|SUBT_BACS9 Subtilisin OS=Bacillus sp. (strain TA39) GN=sub1 PE=1 SV=1 14 171 2.0E-08
sp|F4HSQ2|SBT51_ARATH Subtilisin-like protease SBT5.1 OS=Arabidopsis thaliana GN=SBT5.1 PE=3 SV=1 3 429 2.0E-08
sp|Q9LVJ1|SBT14_ARATH Subtilisin-like protease SBT1.4 OS=Arabidopsis thaliana GN=SBT1.4 PE=2 SV=1 1 432 6.0E-08
sp|Q9C7U8|SBT3H_ARATH Subtilisin-like protease SBT3.17 OS=Arabidopsis thaliana GN=SBT3.17 PE=3 SV=1 5 511 1.0E-07
sp|F4HPF1|SBT34_ARATH Subtilisin-like protease SBT3.4 OS=Arabidopsis thaliana GN=SBT3.4 PE=3 SV=1 6 557 3.0E-07
sp|O64495|SBT12_ARATH Subtilisin-like protease SBT1.2 OS=Arabidopsis thaliana GN=SBT1.2 PE=2 SV=1 69 171 3.0E-06
sp|Q07596|NISP_LACLL Nisin leader peptide-processing serine protease NisP OS=Lactococcus lactis subsp. lactis GN=nisP PE=1 SV=1 17 169 4.0E-06
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 6 159 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0016020 membrane Yes
GO:0005618 cell wall Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0008236 serine-type peptidase activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0004175 endopeptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0043170 macromolecule metabolic process No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0030312 external encapsulating structure No
GO:0008233 peptidase activity No
GO:0044464 cell part No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6708
MSQISKLHEEGNTGDGVKIAIIDSGIDFNHPALGNGCFGRPECLVEMGYDFVGDDFPKKPAVESPEPLDCHGHGT
HVAGIIAAQQTAGNPWGFTGAAPGVKLRAYRVVGCADGTTNTIMLKALARAVQDKPHIISISMSSDNGFPDSVLH
TALSRVVERGIAVLQATGNKGDKGLFFPGSPAKGVVGVANVANRADVDELYRLNFSINDGPQIAAGAKLGLPDDW
ANVSMPLWAGDSCAAESGSQKDLSGHIVLFNFKGCDETLFSSKLRNLTARGARYLLGFSELPMWMNHAPDMIWPD
STGLAGVAGIQIGLGRFWTKKLSQGHTVVVSMPSVDNYEPFYTPALSLAGGSIDKNTSWGPTWDMDVSPNFGAVG
ERILSTFPLRKGGYAVHSGTSMACPLAAAVWALVLRARPRLTASQIANVISTAAEPVYLWDSVAWEIDWTSRAPV
AQQGSGLIKAFRAVHNHAIIQPPSLTFNDTDSFISSATLFLDNINRERVQYRVWHSPAPTMYTLGEGSHYPQEYP
NDIASGASASLSFSIDNVIVEPNQRAEIQVTPTPPSGLDAARLPYWSGFIFINGSDGSRLTVPYHGLSGSIQDAT
VLGPNDVWIAKSTDKQLNRIPKNYTFGIPRHGSRKQAADLPKLVFKVGLATPIVHAYVVPNVAYANVSCGAAKTS
NWMGTRILGGLPSFPYEWQERGTRQVEWTGKLQGGCQVPAGTYKIMVTAKRLRSVEGDANEQRWDTSMTDWFKID
YV*
Coding >Hirsu2|6708
ATGTCTCAGATATCGAAGCTGCATGAGGAGGGCAACACGGGCGACGGTGTCAAGATTGCCATCATCGATTCAGGA
ATTGATTTCAACCACCCGGCCCTTGGAAACGGCTGTTTCGGCCGCCCGGAGTGTCTGGTAGAAATGGGCTACGAC
TTCGTCGGCGACGACTTCCCCAAAAAGCCTGCCGTAGAAAGCCCGGAGCCATTGGACTGCCACGGCCACGGAACA
CACGTGGCGGGCATCATCGCGGCCCAGCAGACGGCCGGCAACCCCTGGGGGTTCACCGGGGCGGCCCCGGGCGTG
AAGCTCCGGGCCTACCGCGTCGTGGGCTGCGCCGACGGAACGACTAACACGATTATGCTTAAAGCCCTTGCCCGC
GCCGTACAAGATAAGCCGCATATTATTTCGATCTCAATGAGCTCCGATAATGGCTTTCCCGACAGTGTCCTGCAT
ACGGCTCTGTCCAGGGTCGTCGAGAGAGGCATCGCCGTCCTCCAGGCCACGGGCAACAAGGGCGATAAGGGCCTC
TTCTTCCCCGGTAGCCCCGCCAAGGGCGTCGTCGGCGTAGCCAACGTCGCGAACCGGGCTGACGTCGATGAGCTG
TACAGACTCAACTTCTCCATTAACGACGGGCCGCAGATCGCCGCCGGCGCCAAGCTTGGCCTTCCCGACGACTGG
GCCAATGTTTCGATGCCTCTCTGGGCCGGCGATTCCTGCGCGGCGGAGAGCGGCAGCCAGAAGGACCTCAGCGGG
CACATTGTCTTGTTCAACTTTAAAGGCTGCGACGAGACCCTGTTCTCATCAAAACTAAGGAATCTGACGGCGCGC
GGCGCCAGATACCTACTTGGCTTCTCTGAATTGCCGATGTGGATGAATCATGCGCCGGATATGATATGGCCTGAC
AGCACTGGCCTCGCCGGAGTTGCGGGCATCCAAATCGGACTGGGCCGTTTCTGGACCAAGAAGCTGAGTCAAGGG
CATACCGTCGTCGTCTCCATGCCTTCCGTAGATAACTACGAGCCCTTCTATACGCCCGCCCTGAGCTTGGCTGGC
GGCAGCATTGACAAGAACACGTCGTGGGGGCCGACTTGGGATATGGACGTCAGCCCAAACTTCGGAGCCGTTGGC
GAGAGAATTCTCTCTACCTTTCCACTCAGAAAGGGTGGCTATGCCGTACATAGCGGCACGTCGATGGCTTGCCCG
CTGGCCGCCGCCGTCTGGGCTCTCGTCCTCCGAGCAAGGCCTCGACTAACGGCGTCACAAATAGCAAACGTGATC
TCAACTGCAGCCGAGCCAGTTTACCTCTGGGATAGCGTTGCCTGGGAGATTGACTGGACTTCTCGGGCTCCCGTG
GCCCAGCAGGGCAGTGGCCTTATCAAGGCCTTCAGAGCGGTGCATAACCACGCAATTATCCAACCCCCGTCCTTA
ACTTTTAACGATACGGATAGCTTTATAAGCTCAGCCACCTTATTTCTCGATAACATTAACCGTGAGAGAGTCCAA
TATCGAGTTTGGCACTCGCCCGCCCCGACTATGTATACGCTGGGTGAGGGGTCTCACTACCCGCAAGAATACCCG
AACGACATTGCTTCGGGCGCCTCGGCTTCGCTGAGCTTCAGCATCGATAACGTTATCGTCGAGCCCAACCAGAGG
GCCGAGATTCAGGTCACGCCTACGCCCCCAAGCGGCCTCGACGCAGCGCGGCTGCCCTACTGGTCGGGCTTCATC
TTTATCAATGGTTCTGATGGCTCGAGACTTACCGTTCCTTACCACGGACTCAGTGGCTCTATTCAGGACGCGACC
GTTCTCGGTCCCAACGATGTCTGGATCGCCAAATCTACCGACAAGCAGCTGAACCGCATCCCGAAGAATTACACC
TTTGGTATCCCACGGCACGGCTCAAGAAAGCAGGCAGCAGATTTACCTAAGCTTGTGTTCAAGGTCGGCCTGGCT
ACGCCTATCGTACATGCCTATGTGGTTCCCAATGTGGCTTACGCCAACGTATCCTGCGGAGCCGCCAAGACTTCC
AATTGGATGGGCACCAGGATCCTGGGTGGACTTCCGAGCTTCCCCTATGAGTGGCAAGAGCGCGGAACGAGACAA
GTTGAGTGGACGGGAAAGCTGCAGGGCGGCTGTCAGGTACCGGCGGGAACCTATAAGATCATGGTGACAGCAAAG
CGCCTGCGGTCCGTTGAAGGTGATGCGAATGAGCAACGCTGGGATACAAGCATGACGGACTGGTTCAAGATAGAC
TACGTGTAG
Transcript >Hirsu2|6708
ATGTCTCAGATATCGAAGCTGCATGAGGAGGGCAACACGGGCGACGGTGTCAAGATTGCCATCATCGATTCAGGA
ATTGATTTCAACCACCCGGCCCTTGGAAACGGCTGTTTCGGCCGCCCGGAGTGTCTGGTAGAAATGGGCTACGAC
TTCGTCGGCGACGACTTCCCCAAAAAGCCTGCCGTAGAAAGCCCGGAGCCATTGGACTGCCACGGCCACGGAACA
CACGTGGCGGGCATCATCGCGGCCCAGCAGACGGCCGGCAACCCCTGGGGGTTCACCGGGGCGGCCCCGGGCGTG
AAGCTCCGGGCCTACCGCGTCGTGGGCTGCGCCGACGGAACGACTAACACGATTATGCTTAAAGCCCTTGCCCGC
GCCGTACAAGATAAGCCGCATATTATTTCGATCTCAATGAGCTCCGATAATGGCTTTCCCGACAGTGTCCTGCAT
ACGGCTCTGTCCAGGGTCGTCGAGAGAGGCATCGCCGTCCTCCAGGCCACGGGCAACAAGGGCGATAAGGGCCTC
TTCTTCCCCGGTAGCCCCGCCAAGGGCGTCGTCGGCGTAGCCAACGTCGCGAACCGGGCTGACGTCGATGAGCTG
TACAGACTCAACTTCTCCATTAACGACGGGCCGCAGATCGCCGCCGGCGCCAAGCTTGGCCTTCCCGACGACTGG
GCCAATGTTTCGATGCCTCTCTGGGCCGGCGATTCCTGCGCGGCGGAGAGCGGCAGCCAGAAGGACCTCAGCGGG
CACATTGTCTTGTTCAACTTTAAAGGCTGCGACGAGACCCTGTTCTCATCAAAACTAAGGAATCTGACGGCGCGC
GGCGCCAGATACCTACTTGGCTTCTCTGAATTGCCGATGTGGATGAATCATGCGCCGGATATGATATGGCCTGAC
AGCACTGGCCTCGCCGGAGTTGCGGGCATCCAAATCGGACTGGGCCGTTTCTGGACCAAGAAGCTGAGTCAAGGG
CATACCGTCGTCGTCTCCATGCCTTCCGTAGATAACTACGAGCCCTTCTATACGCCCGCCCTGAGCTTGGCTGGC
GGCAGCATTGACAAGAACACGTCGTGGGGGCCGACTTGGGATATGGACGTCAGCCCAAACTTCGGAGCCGTTGGC
GAGAGAATTCTCTCTACCTTTCCACTCAGAAAGGGTGGCTATGCCGTACATAGCGGCACGTCGATGGCTTGCCCG
CTGGCCGCCGCCGTCTGGGCTCTCGTCCTCCGAGCAAGGCCTCGACTAACGGCGTCACAAATAGCAAACGTGATC
TCAACTGCAGCCGAGCCAGTTTACCTCTGGGATAGCGTTGCCTGGGAGATTGACTGGACTTCTCGGGCTCCCGTG
GCCCAGCAGGGCAGTGGCCTTATCAAGGCCTTCAGAGCGGTGCATAACCACGCAATTATCCAACCCCCGTCCTTA
ACTTTTAACGATACGGATAGCTTTATAAGCTCAGCCACCTTATTTCTCGATAACATTAACCGTGAGAGAGTCCAA
TATCGAGTTTGGCACTCGCCCGCCCCGACTATGTATACGCTGGGTGAGGGGTCTCACTACCCGCAAGAATACCCG
AACGACATTGCTTCGGGCGCCTCGGCTTCGCTGAGCTTCAGCATCGATAACGTTATCGTCGAGCCCAACCAGAGG
GCCGAGATTCAGGTCACGCCTACGCCCCCAAGCGGCCTCGACGCAGCGCGGCTGCCCTACTGGTCGGGCTTCATC
TTTATCAATGGTTCTGATGGCTCGAGACTTACCGTTCCTTACCACGGACTCAGTGGCTCTATTCAGGACGCGACC
GTTCTCGGTCCCAACGATGTCTGGATCGCCAAATCTACCGACAAGCAGCTGAACCGCATCCCGAAGAATTACACC
TTTGGTATCCCACGGCACGGCTCAAGAAAGCAGGCAGCAGATTTACCTAAGCTTGTGTTCAAGGTCGGCCTGGCT
ACGCCTATCGTACATGCCTATGTGGTTCCCAATGTGGCTTACGCCAACGTATCCTGCGGAGCCGCCAAGACTTCC
AATTGGATGGGCACCAGGATCCTGGGTGGACTTCCGAGCTTCCCCTATGAGTGGCAAGAGCGCGGAACGAGACAA
GTTGAGTGGACGGGAAAGCTGCAGGGCGGCTGTCAGGTACCGGCGGGAACCTATAAGATCATGGTGACAGCAAAG
CGCCTGCGGTCCGTTGAAGGTGATGCGAATGAGCAACGCTGGGATACAAGCATGACGGACTGGTTCAAGATAGAC
TACGTGTAG
Gene >Hirsu2|6708
ATGTCTCAGATATCGAAGCTGCATGAGGAGGGCAACACGGGCGACGGTGTCAAGATTGCCATCATCGATTCAGGA
GTATGTATCACATACATAAACTGAGCTCAGCACTGCACAGAAGTCTGTGCCAGATGGACGGTAGCTCTCCCATGT
ACACACGTGCTGACTGGAACCCTTTCTCCCGTCGCATAGATTGATTTCAACCACCCGGCCCTTGGAAACGGCTGT
TTCGGCCGCCCGGAGTGTCTGGTAGAAATGGGCTACGACTTCGTCGGCGACGACTTCCCCAAAAAGCCTGCCGTA
GAAAGCCCGGAGCCATTGGACTGCCACGGCCACGGAACACACGTGGCGGGCATCATCGCGGCCCAGCAGACGGCC
GGCAACCCCTGGGGGTTCACCGGGGCGGCCCCGGGCGTGAAGCTCCGGGCCTACCGCGTCGTGGGCTGCGCCGAC
GGAACGACTAACACGATTATGCTTAAAGCCCTTGCCCGCGCCGTACAAGATAAGCCGCATATTATTTCGATCTCA
ATGAGCTCCGATAATGGCTTTCCCGACAGTGTCCTGCATACGGCTCTGTCCAGGGTCGTCGAGAGAGGCATCGCC
GTCCTCCAGGCCACGGGCAACAAGGGCGATAAGGGCCTCTTCTTCCCCGGTAGCCCCGCCAAGGGCGTCGTCGGC
GTAGCCAACGTCGCGAACCGGGCTGACGTCGATGAGCTGTACAGACTCAACTTCTCCATTAACGACGGGCCGCAG
ATCGCCGCCGGCGCCAAGCTTGGCCTTCCCGACGACTGGGCCAATGTTTCGATGCCTCTCTGGGCCGGCGATTCC
TGCGCGGCGGAGAGCGGCAGCCAGAAGGACCTCAGCGGGCACATTGTCTTGTTCAACTTTAAAGGCTGCGACGAG
ACCCTGTTCTCATCAAAACTAAGGAATCTGACGGCGCGCGGCGCCAGATACCTACTTGGCTTCTCTGAATTGCCG
ATGTGGATGAATCATGCGCCGGATATGATATGGCCTGACAGCACTGGCCTCGCCGGAGTTGCGGGCATCCAAATC
GGACTGGGCCGTTTCTGGACCAAGAAGCTGAGTCAAGGGCATACCGTCGTCGTCTCCATGCCTTCCGTAGATAAC
TACGAGCCCTTCTATACGCCCGCCCTGAGCTTGGCTGGCGGCAGCATTGACAAGAACACGTCGTGGGGGCCGACT
TGGGATATGGACGTCAGCCCAAACTTCGGAGCCGTTGGCGAGAGAATTCTCTCTACCTTTCCACTCAGAAAGGGT
GGCTATGCCGTACATAGCGGCACGTCGATGGCTTGCCCGCTGGCCGCCGCCGTCTGGGCTCTCGTCCTCCGAGCA
AGGCCTCGACTAACGGCGTCACAAATAGCAAACGTGATCTCAACTGCAGCCGAGCCAGTTTACCTCTGGGATAGC
GTTGCCTGGGAGATTGACTGGACTTCTCGGGCTCCCGTGGCCCAGCAGGGCAGTGGCCTTATCAAGGCCTTCAGA
GCGGTGCATAACCACGCAATTATCCAACCCCCGTCCTTAACTTTTAACGATACGGATAGCTTTATAAGCTCAGCC
ACCTTATTTCTCGATAACATTAACCGTGAGAGAGTCCAATATCGAGTTTGGCACTCGCCCGCCCCGACTATGTAT
ACGCTGGGTGAGGGGTCTCACTACCCGCAAGAATACCCGAACGACATTGCTTCGGGCGCCTCGGCTTCGCTGAGC
TTCAGCATCGATAACGTTATCGTCGAGCCCAACCAGAGGGCCGAGATTCAGGTCACGCCTACGCCCCCAAGCGGC
CTCGACGCAGCGCGGCTGCCCTACTGGTCGGGCTTCATCTTTATCAATGGTTCTGATGGCTCGAGACTTACCGTT
CCTTACCACGGACTCAGTGGCTCTATTCAGGACGCGACCGTTCTCGGTCCCAACGATGTCTGGATCGCCAAATCT
ACCGACAAGCAGCTGAACCGCATCCCGAAGAATTACACCTTTGGTATCCCACGGCACGGCTCAAGAAAGCAGGCA
GCAGATTTACCTAAGCTTGTGTTCAAGGTCGGCCTGGCTACGCCTATCGTACATGCCTATGTGGTTCCCAATGTG
GCTTACGCCAACGTATCCTGCGGAGCCGCCAAGACTTCCAATTGGATGGGCACCAGGATCCTGGGTGGACTTCCG
AGCTTCCCCTATGAGTGGCAAGAGCGCGGAACGAGACAAGTTGAGTGGACGGGAAAGCTGCAGGGCGGCTGTCAG
GTACCGGCGGGAACCTATAAGATCATGGTGACAGCAAAGCGCCTGCGGTCCGTTGAAGGTGATGCGAATGAGCAA
CGCTGGGATACAAGCATGACGGACTGGTTCAAGATAGACTACGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail