Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6708
Gene name
LocationContig_353:8264..10637
Strand-
Gene length (bp)2373
Transcript length (bp)2259
Coding sequence length (bp)2259
Protein length (aa) 753

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 7.6E-39 14 429
PF06280 fn3_5 Fn3-like domain 1.3E-16 476 589

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 11 506 3.0E-30
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 10 208 8.0E-17
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 3 178 7.0E-15
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 1 194 1.0E-14
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 16 180 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 11 506 3.0E-30
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 10 208 8.0E-17
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 3 178 7.0E-15
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 1 194 1.0E-14
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 16 180 2.0E-14
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 3 178 2.0E-14
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 1 194 3.0E-14
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 1 194 3.0E-14
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 3 178 2.0E-13
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 3 178 2.0E-13
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 3 178 2.0E-13
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 14 172 4.0E-13
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 1 170 4.0E-12
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 1 170 4.0E-12
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 6 174 9.0E-11
sp|Q9SA75|SBT21_ARATH Subtilisin-like protease SBT2.1 OS=Arabidopsis thaliana GN=SBT2.1 PE=2 SV=1 14 492 1.0E-10
sp|P54423|WPRA_BACSU Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 19 197 3.0E-10
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 14 164 5.0E-10
sp|P80146|SEPR_THESR Extracellular serine proteinase OS=Thermus sp. (strain Rt41A) PE=1 SV=3 13 206 6.0E-10
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 8 178 2.0E-09
sp|P41363|ELYA_BACHD Thermostable alkaline protease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0855 PE=1 SV=2 6 191 8.0E-09
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 1 213 9.0E-09
sp|P28842|SUBT_BACS9 Subtilisin OS=Bacillus sp. (strain TA39) GN=sub1 PE=1 SV=1 14 171 2.0E-08
sp|F4HSQ2|SBT51_ARATH Subtilisin-like protease SBT5.1 OS=Arabidopsis thaliana GN=SBT5.1 PE=3 SV=1 3 429 2.0E-08
sp|Q9LVJ1|SBT14_ARATH Subtilisin-like protease SBT1.4 OS=Arabidopsis thaliana GN=SBT1.4 PE=2 SV=1 1 432 6.0E-08
sp|Q9C7U8|SBT3H_ARATH Subtilisin-like protease SBT3.17 OS=Arabidopsis thaliana GN=SBT3.17 PE=3 SV=1 5 511 1.0E-07
sp|F4HPF1|SBT34_ARATH Subtilisin-like protease SBT3.4 OS=Arabidopsis thaliana GN=SBT3.4 PE=3 SV=1 6 557 3.0E-07
sp|O64495|SBT12_ARATH Subtilisin-like protease SBT1.2 OS=Arabidopsis thaliana GN=SBT1.2 PE=2 SV=1 69 171 3.0E-06
sp|Q07596|NISP_LACLL Nisin leader peptide-processing serine protease NisP OS=Lactococcus lactis subsp. lactis GN=nisP PE=1 SV=1 17 169 4.0E-06
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 6 159 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0016020 membrane Yes
GO:0008236 serine-type peptidase activity Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0005618 cell wall Yes
GO:0017171 serine hydrolase activity No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0019538 protein metabolic process No
GO:0003824 catalytic activity No
GO:0030312 external encapsulating structure No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0008233 peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular Signal peptide 0.5516 0.2876 0.7866 0.0482 0.0461 0.0399 0.2381 0.1403 0.1464 0.0114

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup13
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|899
Ophiocordyceps australis 1348a (Ghana) OphauG2|6186
Ophiocordyceps australis 1348a (Ghana) OphauG2|5995
Ophiocordyceps australis 1348a (Ghana) OphauG2|2920
Ophiocordyceps australis 1348a (Ghana) OphauG2|2766
Ophiocordyceps australis 1348a (Ghana) OphauG2|2711
Ophiocordyceps australis map64 (Brazil) OphauB2|5626
Ophiocordyceps australis map64 (Brazil) OphauB2|247
Ophiocordyceps australis map64 (Brazil) OphauB2|2915
Ophiocordyceps australis map64 (Brazil) OphauB2|4024
Ophiocordyceps camponoti-floridani Ophcf2|06941
Ophiocordyceps camponoti-floridani Ophcf2|06362
Ophiocordyceps camponoti-rufipedis Ophun1|6441
Ophiocordyceps camponoti-rufipedis Ophun1|2138
Ophiocordyceps kimflemingae Ophio5|4117
Ophiocordyceps kimflemingae Ophio5|496
Ophiocordyceps kimflemingae Ophio5|5244
Ophiocordyceps subramaniannii Hirsu2|6708 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5374
Ophiocordyceps subramaniannii Hirsu2|4743
Ophiocordyceps subramaniannii Hirsu2|4682
Ophiocordyceps subramaniannii Hirsu2|4026
Ophiocordyceps subramaniannii Hirsu2|1356
Ophiocordyceps subramaniannii Hirsu2|11115
Ophiocordyceps subramaniannii Hirsu2|1111
Ophiocordyceps subramaniannii Hirsu2|10934

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6708
MSQISKLHEEGNTGDGVKIAIIDSGIDFNHPALGNGCFGRPECLVEMGYDFVGDDFPKKPAVESPEPLDCHGHGT
HVAGIIAAQQTAGNPWGFTGAAPGVKLRAYRVVGCADGTTNTIMLKALARAVQDKPHIISISMSSDNGFPDSVLH
TALSRVVERGIAVLQATGNKGDKGLFFPGSPAKGVVGVANVANRADVDELYRLNFSINDGPQIAAGAKLGLPDDW
ANVSMPLWAGDSCAAESGSQKDLSGHIVLFNFKGCDETLFSSKLRNLTARGARYLLGFSELPMWMNHAPDMIWPD
STGLAGVAGIQIGLGRFWTKKLSQGHTVVVSMPSVDNYEPFYTPALSLAGGSIDKNTSWGPTWDMDVSPNFGAVG
ERILSTFPLRKGGYAVHSGTSMACPLAAAVWALVLRARPRLTASQIANVISTAAEPVYLWDSVAWEIDWTSRAPV
AQQGSGLIKAFRAVHNHAIIQPPSLTFNDTDSFISSATLFLDNINRERVQYRVWHSPAPTMYTLGEGSHYPQEYP
NDIASGASASLSFSIDNVIVEPNQRAEIQVTPTPPSGLDAARLPYWSGFIFINGSDGSRLTVPYHGLSGSIQDAT
VLGPNDVWIAKSTDKQLNRIPKNYTFGIPRHGSRKQAADLPKLVFKVGLATPIVHAYVVPNVAYANVSCGAAKTS
NWMGTRILGGLPSFPYEWQERGTRQVEWTGKLQGGCQVPAGTYKIMVTAKRLRSVEGDANEQRWDTSMTDWFKID
YV*
Coding >Hirsu2|6708
ATGTCTCAGATATCGAAGCTGCATGAGGAGGGCAACACGGGCGACGGTGTCAAGATTGCCATCATCGATTCAGGA
ATTGATTTCAACCACCCGGCCCTTGGAAACGGCTGTTTCGGCCGCCCGGAGTGTCTGGTAGAAATGGGCTACGAC
TTCGTCGGCGACGACTTCCCCAAAAAGCCTGCCGTAGAAAGCCCGGAGCCATTGGACTGCCACGGCCACGGAACA
CACGTGGCGGGCATCATCGCGGCCCAGCAGACGGCCGGCAACCCCTGGGGGTTCACCGGGGCGGCCCCGGGCGTG
AAGCTCCGGGCCTACCGCGTCGTGGGCTGCGCCGACGGAACGACTAACACGATTATGCTTAAAGCCCTTGCCCGC
GCCGTACAAGATAAGCCGCATATTATTTCGATCTCAATGAGCTCCGATAATGGCTTTCCCGACAGTGTCCTGCAT
ACGGCTCTGTCCAGGGTCGTCGAGAGAGGCATCGCCGTCCTCCAGGCCACGGGCAACAAGGGCGATAAGGGCCTC
TTCTTCCCCGGTAGCCCCGCCAAGGGCGTCGTCGGCGTAGCCAACGTCGCGAACCGGGCTGACGTCGATGAGCTG
TACAGACTCAACTTCTCCATTAACGACGGGCCGCAGATCGCCGCCGGCGCCAAGCTTGGCCTTCCCGACGACTGG
GCCAATGTTTCGATGCCTCTCTGGGCCGGCGATTCCTGCGCGGCGGAGAGCGGCAGCCAGAAGGACCTCAGCGGG
CACATTGTCTTGTTCAACTTTAAAGGCTGCGACGAGACCCTGTTCTCATCAAAACTAAGGAATCTGACGGCGCGC
GGCGCCAGATACCTACTTGGCTTCTCTGAATTGCCGATGTGGATGAATCATGCGCCGGATATGATATGGCCTGAC
AGCACTGGCCTCGCCGGAGTTGCGGGCATCCAAATCGGACTGGGCCGTTTCTGGACCAAGAAGCTGAGTCAAGGG
CATACCGTCGTCGTCTCCATGCCTTCCGTAGATAACTACGAGCCCTTCTATACGCCCGCCCTGAGCTTGGCTGGC
GGCAGCATTGACAAGAACACGTCGTGGGGGCCGACTTGGGATATGGACGTCAGCCCAAACTTCGGAGCCGTTGGC
GAGAGAATTCTCTCTACCTTTCCACTCAGAAAGGGTGGCTATGCCGTACATAGCGGCACGTCGATGGCTTGCCCG
CTGGCCGCCGCCGTCTGGGCTCTCGTCCTCCGAGCAAGGCCTCGACTAACGGCGTCACAAATAGCAAACGTGATC
TCAACTGCAGCCGAGCCAGTTTACCTCTGGGATAGCGTTGCCTGGGAGATTGACTGGACTTCTCGGGCTCCCGTG
GCCCAGCAGGGCAGTGGCCTTATCAAGGCCTTCAGAGCGGTGCATAACCACGCAATTATCCAACCCCCGTCCTTA
ACTTTTAACGATACGGATAGCTTTATAAGCTCAGCCACCTTATTTCTCGATAACATTAACCGTGAGAGAGTCCAA
TATCGAGTTTGGCACTCGCCCGCCCCGACTATGTATACGCTGGGTGAGGGGTCTCACTACCCGCAAGAATACCCG
AACGACATTGCTTCGGGCGCCTCGGCTTCGCTGAGCTTCAGCATCGATAACGTTATCGTCGAGCCCAACCAGAGG
GCCGAGATTCAGGTCACGCCTACGCCCCCAAGCGGCCTCGACGCAGCGCGGCTGCCCTACTGGTCGGGCTTCATC
TTTATCAATGGTTCTGATGGCTCGAGACTTACCGTTCCTTACCACGGACTCAGTGGCTCTATTCAGGACGCGACC
GTTCTCGGTCCCAACGATGTCTGGATCGCCAAATCTACCGACAAGCAGCTGAACCGCATCCCGAAGAATTACACC
TTTGGTATCCCACGGCACGGCTCAAGAAAGCAGGCAGCAGATTTACCTAAGCTTGTGTTCAAGGTCGGCCTGGCT
ACGCCTATCGTACATGCCTATGTGGTTCCCAATGTGGCTTACGCCAACGTATCCTGCGGAGCCGCCAAGACTTCC
AATTGGATGGGCACCAGGATCCTGGGTGGACTTCCGAGCTTCCCCTATGAGTGGCAAGAGCGCGGAACGAGACAA
GTTGAGTGGACGGGAAAGCTGCAGGGCGGCTGTCAGGTACCGGCGGGAACCTATAAGATCATGGTGACAGCAAAG
CGCCTGCGGTCCGTTGAAGGTGATGCGAATGAGCAACGCTGGGATACAAGCATGACGGACTGGTTCAAGATAGAC
TACGTGTAG
Transcript >Hirsu2|6708
ATGTCTCAGATATCGAAGCTGCATGAGGAGGGCAACACGGGCGACGGTGTCAAGATTGCCATCATCGATTCAGGA
ATTGATTTCAACCACCCGGCCCTTGGAAACGGCTGTTTCGGCCGCCCGGAGTGTCTGGTAGAAATGGGCTACGAC
TTCGTCGGCGACGACTTCCCCAAAAAGCCTGCCGTAGAAAGCCCGGAGCCATTGGACTGCCACGGCCACGGAACA
CACGTGGCGGGCATCATCGCGGCCCAGCAGACGGCCGGCAACCCCTGGGGGTTCACCGGGGCGGCCCCGGGCGTG
AAGCTCCGGGCCTACCGCGTCGTGGGCTGCGCCGACGGAACGACTAACACGATTATGCTTAAAGCCCTTGCCCGC
GCCGTACAAGATAAGCCGCATATTATTTCGATCTCAATGAGCTCCGATAATGGCTTTCCCGACAGTGTCCTGCAT
ACGGCTCTGTCCAGGGTCGTCGAGAGAGGCATCGCCGTCCTCCAGGCCACGGGCAACAAGGGCGATAAGGGCCTC
TTCTTCCCCGGTAGCCCCGCCAAGGGCGTCGTCGGCGTAGCCAACGTCGCGAACCGGGCTGACGTCGATGAGCTG
TACAGACTCAACTTCTCCATTAACGACGGGCCGCAGATCGCCGCCGGCGCCAAGCTTGGCCTTCCCGACGACTGG
GCCAATGTTTCGATGCCTCTCTGGGCCGGCGATTCCTGCGCGGCGGAGAGCGGCAGCCAGAAGGACCTCAGCGGG
CACATTGTCTTGTTCAACTTTAAAGGCTGCGACGAGACCCTGTTCTCATCAAAACTAAGGAATCTGACGGCGCGC
GGCGCCAGATACCTACTTGGCTTCTCTGAATTGCCGATGTGGATGAATCATGCGCCGGATATGATATGGCCTGAC
AGCACTGGCCTCGCCGGAGTTGCGGGCATCCAAATCGGACTGGGCCGTTTCTGGACCAAGAAGCTGAGTCAAGGG
CATACCGTCGTCGTCTCCATGCCTTCCGTAGATAACTACGAGCCCTTCTATACGCCCGCCCTGAGCTTGGCTGGC
GGCAGCATTGACAAGAACACGTCGTGGGGGCCGACTTGGGATATGGACGTCAGCCCAAACTTCGGAGCCGTTGGC
GAGAGAATTCTCTCTACCTTTCCACTCAGAAAGGGTGGCTATGCCGTACATAGCGGCACGTCGATGGCTTGCCCG
CTGGCCGCCGCCGTCTGGGCTCTCGTCCTCCGAGCAAGGCCTCGACTAACGGCGTCACAAATAGCAAACGTGATC
TCAACTGCAGCCGAGCCAGTTTACCTCTGGGATAGCGTTGCCTGGGAGATTGACTGGACTTCTCGGGCTCCCGTG
GCCCAGCAGGGCAGTGGCCTTATCAAGGCCTTCAGAGCGGTGCATAACCACGCAATTATCCAACCCCCGTCCTTA
ACTTTTAACGATACGGATAGCTTTATAAGCTCAGCCACCTTATTTCTCGATAACATTAACCGTGAGAGAGTCCAA
TATCGAGTTTGGCACTCGCCCGCCCCGACTATGTATACGCTGGGTGAGGGGTCTCACTACCCGCAAGAATACCCG
AACGACATTGCTTCGGGCGCCTCGGCTTCGCTGAGCTTCAGCATCGATAACGTTATCGTCGAGCCCAACCAGAGG
GCCGAGATTCAGGTCACGCCTACGCCCCCAAGCGGCCTCGACGCAGCGCGGCTGCCCTACTGGTCGGGCTTCATC
TTTATCAATGGTTCTGATGGCTCGAGACTTACCGTTCCTTACCACGGACTCAGTGGCTCTATTCAGGACGCGACC
GTTCTCGGTCCCAACGATGTCTGGATCGCCAAATCTACCGACAAGCAGCTGAACCGCATCCCGAAGAATTACACC
TTTGGTATCCCACGGCACGGCTCAAGAAAGCAGGCAGCAGATTTACCTAAGCTTGTGTTCAAGGTCGGCCTGGCT
ACGCCTATCGTACATGCCTATGTGGTTCCCAATGTGGCTTACGCCAACGTATCCTGCGGAGCCGCCAAGACTTCC
AATTGGATGGGCACCAGGATCCTGGGTGGACTTCCGAGCTTCCCCTATGAGTGGCAAGAGCGCGGAACGAGACAA
GTTGAGTGGACGGGAAAGCTGCAGGGCGGCTGTCAGGTACCGGCGGGAACCTATAAGATCATGGTGACAGCAAAG
CGCCTGCGGTCCGTTGAAGGTGATGCGAATGAGCAACGCTGGGATACAAGCATGACGGACTGGTTCAAGATAGAC
TACGTGTAG
Gene >Hirsu2|6708
ATGTCTCAGATATCGAAGCTGCATGAGGAGGGCAACACGGGCGACGGTGTCAAGATTGCCATCATCGATTCAGGA
GTATGTATCACATACATAAACTGAGCTCAGCACTGCACAGAAGTCTGTGCCAGATGGACGGTAGCTCTCCCATGT
ACACACGTGCTGACTGGAACCCTTTCTCCCGTCGCATAGATTGATTTCAACCACCCGGCCCTTGGAAACGGCTGT
TTCGGCCGCCCGGAGTGTCTGGTAGAAATGGGCTACGACTTCGTCGGCGACGACTTCCCCAAAAAGCCTGCCGTA
GAAAGCCCGGAGCCATTGGACTGCCACGGCCACGGAACACACGTGGCGGGCATCATCGCGGCCCAGCAGACGGCC
GGCAACCCCTGGGGGTTCACCGGGGCGGCCCCGGGCGTGAAGCTCCGGGCCTACCGCGTCGTGGGCTGCGCCGAC
GGAACGACTAACACGATTATGCTTAAAGCCCTTGCCCGCGCCGTACAAGATAAGCCGCATATTATTTCGATCTCA
ATGAGCTCCGATAATGGCTTTCCCGACAGTGTCCTGCATACGGCTCTGTCCAGGGTCGTCGAGAGAGGCATCGCC
GTCCTCCAGGCCACGGGCAACAAGGGCGATAAGGGCCTCTTCTTCCCCGGTAGCCCCGCCAAGGGCGTCGTCGGC
GTAGCCAACGTCGCGAACCGGGCTGACGTCGATGAGCTGTACAGACTCAACTTCTCCATTAACGACGGGCCGCAG
ATCGCCGCCGGCGCCAAGCTTGGCCTTCCCGACGACTGGGCCAATGTTTCGATGCCTCTCTGGGCCGGCGATTCC
TGCGCGGCGGAGAGCGGCAGCCAGAAGGACCTCAGCGGGCACATTGTCTTGTTCAACTTTAAAGGCTGCGACGAG
ACCCTGTTCTCATCAAAACTAAGGAATCTGACGGCGCGCGGCGCCAGATACCTACTTGGCTTCTCTGAATTGCCG
ATGTGGATGAATCATGCGCCGGATATGATATGGCCTGACAGCACTGGCCTCGCCGGAGTTGCGGGCATCCAAATC
GGACTGGGCCGTTTCTGGACCAAGAAGCTGAGTCAAGGGCATACCGTCGTCGTCTCCATGCCTTCCGTAGATAAC
TACGAGCCCTTCTATACGCCCGCCCTGAGCTTGGCTGGCGGCAGCATTGACAAGAACACGTCGTGGGGGCCGACT
TGGGATATGGACGTCAGCCCAAACTTCGGAGCCGTTGGCGAGAGAATTCTCTCTACCTTTCCACTCAGAAAGGGT
GGCTATGCCGTACATAGCGGCACGTCGATGGCTTGCCCGCTGGCCGCCGCCGTCTGGGCTCTCGTCCTCCGAGCA
AGGCCTCGACTAACGGCGTCACAAATAGCAAACGTGATCTCAACTGCAGCCGAGCCAGTTTACCTCTGGGATAGC
GTTGCCTGGGAGATTGACTGGACTTCTCGGGCTCCCGTGGCCCAGCAGGGCAGTGGCCTTATCAAGGCCTTCAGA
GCGGTGCATAACCACGCAATTATCCAACCCCCGTCCTTAACTTTTAACGATACGGATAGCTTTATAAGCTCAGCC
ACCTTATTTCTCGATAACATTAACCGTGAGAGAGTCCAATATCGAGTTTGGCACTCGCCCGCCCCGACTATGTAT
ACGCTGGGTGAGGGGTCTCACTACCCGCAAGAATACCCGAACGACATTGCTTCGGGCGCCTCGGCTTCGCTGAGC
TTCAGCATCGATAACGTTATCGTCGAGCCCAACCAGAGGGCCGAGATTCAGGTCACGCCTACGCCCCCAAGCGGC
CTCGACGCAGCGCGGCTGCCCTACTGGTCGGGCTTCATCTTTATCAATGGTTCTGATGGCTCGAGACTTACCGTT
CCTTACCACGGACTCAGTGGCTCTATTCAGGACGCGACCGTTCTCGGTCCCAACGATGTCTGGATCGCCAAATCT
ACCGACAAGCAGCTGAACCGCATCCCGAAGAATTACACCTTTGGTATCCCACGGCACGGCTCAAGAAAGCAGGCA
GCAGATTTACCTAAGCTTGTGTTCAAGGTCGGCCTGGCTACGCCTATCGTACATGCCTATGTGGTTCCCAATGTG
GCTTACGCCAACGTATCCTGCGGAGCCGCCAAGACTTCCAATTGGATGGGCACCAGGATCCTGGGTGGACTTCCG
AGCTTCCCCTATGAGTGGCAAGAGCGCGGAACGAGACAAGTTGAGTGGACGGGAAAGCTGCAGGGCGGCTGTCAG
GTACCGGCGGGAACCTATAAGATCATGGTGACAGCAAAGCGCCTGCGGTCCGTTGAAGGTGATGCGAATGAGCAA
CGCTGGGATACAAGCATGACGGACTGGTTCAAGATAGACTACGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail