Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6706
Gene name
LocationContig_353:1988..4236
Strand-
Gene length (bp)2248
Transcript length (bp)2085
Coding sequence length (bp)2085
Protein length (aa) 695

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03828 PAP_assoc Cid1 family poly A polymerase 3.4E-12 565 620
PF01909 NTP_transf_2 Nucleotidyltransferase domain 4.8E-07 397 492

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48561|TRF5_YEAST Poly(A) RNA polymerase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRF5 PE=1 SV=2 266 677 5.0E-52
sp|Q68ED3|PAPD5_MOUSE Non-canonical poly(A) RNA polymerase PAPD5 OS=Mus musculus GN=Papd5 PE=1 SV=2 344 654 2.0E-50
sp|Q8NDF8|PAPD5_HUMAN Non-canonical poly(A) RNA polymerase PAPD5 OS=Homo sapiens GN=PAPD5 PE=1 SV=2 344 654 3.0E-50
sp|P53632|PAP2_YEAST Poly(A) RNA polymerase protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAP2 PE=1 SV=1 343 668 3.0E-49
sp|Q5XG87|PAPD7_HUMAN Non-canonical poly(A) RNA polymerase PAPD7 OS=Homo sapiens GN=PAPD7 PE=1 SV=3 360 664 2.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48561|TRF5_YEAST Poly(A) RNA polymerase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRF5 PE=1 SV=2 266 677 5.0E-52
sp|Q68ED3|PAPD5_MOUSE Non-canonical poly(A) RNA polymerase PAPD5 OS=Mus musculus GN=Papd5 PE=1 SV=2 344 654 2.0E-50
sp|Q8NDF8|PAPD5_HUMAN Non-canonical poly(A) RNA polymerase PAPD5 OS=Homo sapiens GN=PAPD5 PE=1 SV=2 344 654 3.0E-50
sp|P53632|PAP2_YEAST Poly(A) RNA polymerase protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAP2 PE=1 SV=1 343 668 3.0E-49
sp|Q5XG87|PAPD7_HUMAN Non-canonical poly(A) RNA polymerase PAPD7 OS=Homo sapiens GN=PAPD7 PE=1 SV=3 360 664 2.0E-47
sp|Q9HFW3|TRF5_ASHGO Poly(A) RNA polymerase protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRF5 PE=3 SV=1 343 680 7.0E-47
sp|Q9UTN3|CID14_SCHPO Poly(A) RNA polymerase cid14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid14 PE=1 SV=2 342 655 3.0E-45
sp|Q6PB75|PAPD7_MOUSE Non-canonical poly(A) RNA polymerase PAPD7 OS=Mus musculus GN=Papd7 PE=2 SV=2 377 664 5.0E-41
sp|G5EFL0|GLD4_CAEEL Poly(A) RNA polymerase gld-4 OS=Caenorhabditis elegans GN=gld-4 PE=1 SV=1 311 666 1.0E-38
sp|O74518|CID12_SCHPO Poly(A) RNA polymerase cid12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid12 PE=1 SV=1 342 638 2.0E-09
sp|O74326|CID11_SCHPO Poly(A) RNA polymerase cid11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid11 PE=3 SV=1 359 670 8.0E-09
sp|Q503I9|GLD2_DANRE Poly(A) RNA polymerase GLD2 OS=Danio rerio GN=papd4 PE=2 SV=1 386 589 1.0E-08
sp|Q6DFA8|GLD2B_XENLA Poly(A) RNA polymerase GLD2-B OS=Xenopus laevis GN=papd4-b PE=1 SV=1 359 647 2.0E-08
sp|Q91YI6|GLD2_MOUSE Poly(A) RNA polymerase GLD2 OS=Mus musculus GN=Papd4 PE=1 SV=1 359 589 2.0E-08
sp|Q5U315|GLD2_RAT Poly(A) RNA polymerase GLD2 OS=Rattus norvegicus GN=Papd4 PE=2 SV=1 359 589 2.0E-08
sp|Q5XET5|HESO1_ARATH Protein HESO1 OS=Arabidopsis thaliana GN=HESO1 PE=1 SV=1 364 549 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016779 nucleotidyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4314 0.8707 0.1435 0.0139 0.1524 0.0102 0.0251 0.0116 0.003 0.0103

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3504
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1281
Ophiocordyceps australis map64 (Brazil) OphauB2|4572
Ophiocordyceps camponoti-floridani Ophcf2|01660
Ophiocordyceps camponoti-rufipedis Ophun1|201
Ophiocordyceps kimflemingae Ophio5|3694
Ophiocordyceps subramaniannii Hirsu2|6706 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6706
MSRNDPRSWRRDDRDRGSSRYRPSSPPLPSYDSWRPSGSRPDRDRRPSGDSYRQFDTNRGGDSYRTADVYRPSLP
QSSFDFRVEKPGGIAPIVFPPGNQLPAGPRRDRRGPPRGKPGRRWQPPPHPSERALVSGDTYRLPGERVHDADAA
AKFRDLDELSDDEEVDMDMSSSRSGSQDPAPKRVRTDDKPDEADAVPKWSNPDPYTALPCPDETTRKKRDMVKLI
RKARVDEAKPNTDTPAQAEDFISFDLSSDGEDTKPAPPSHLPPRPPSGPRADRADADRGTKNGSAVVNKDANPLG
SRKRTFDDEIKPPDYGQLNKLHMKPSKGALVPDWQPKHGEDSYPWATEHCTHGDNMAVRLHKEIMDFYDFVKPRE
FERRIRSNLIENLKAAMKRDGRTFGLAHVEPFGSFMSGLYLPTADMDLVVCSPMFMKGGPATYLSARSWLYKFSK
LLVAQKVADAASVQVIAHARIPLVKFVDKLTGLKVDVSFENRGGVEAIDTFLRWKKDYPAMPILVTVIKHFLLMR
GLNEPVNGGIGGFSVICLVVSMLQMMPQVQSRSIHAQHHLGELLLDFFELYGRHFQYQTNAISLTHPVGYVRKSD
VRTFVYRNSNRLSIIDPNNSGNDIAGGSSNTPAIMDRFHDAYLTLRDRMGEVARRRDKGRILDVILGGNYSSFRM
QRAFLKHVHEETVGPCSDA*
Coding >Hirsu2|6706
ATGTCGCGCAACGACCCGCGCTCGTGGCGGCGCGATGACCGAGACCGCGGCAGCTCTCGCTACCGCCCATCGTCG
CCGCCGCTGCCTTCGTACGACAGCTGGCGCCCCTCGGGCAGTCGCCCGGACCGCGACCGCCGCCCCAGCGGCGAC
TCGTATCGCCAGTTCGACACGAACCGTGGCGGCGACTCGTACCGCACTGCCGACGTCTACCGCCCGTCGCTTCCC
CAGAGCAGCTTCGACTTCCGGGTCGAAAAGCCGGGCGGGATCGCGCCCATCGTCTTCCCCCCTGGCAACCAGCTG
CCCGCCGGCCCCCGCCGCGACCGTCGTGGGCCGCCGCGCGGGAAGCCGGGCCGTCGCTGGCAGCCTCCCCCTCAC
CCCTCGGAGCGAGCACTCGTCTCGGGCGATACCTATCGTCTACCCGGAGAGCGCGTCCACGACGCGGACGCCGCT
GCCAAGTTCCGCGACCTCGACGAGCTGTCGGACGACGAAGAGGTCGACATGGACATGTCGTCCTCGCGTTCCGGC
TCCCAAGATCCCGCCCCAAAGCGCGTGCGCACCGACGACAAGCCTGACGAGGCCGACGCCGTCCCCAAGTGGTCC
AACCCTGACCCCTACACTGCGCTGCCCTGTCCGGACGAGACGACGCGCAAGAAGCGCGACATGGTGAAGCTCATC
CGCAAAGCTCGCGTCGACGAGGCCAAGCCAAACACCGACACCCCTGCCCAGGCCGAGGACTTCATCTCATTCGAC
CTCTCCAGCGACGGCGAGGACACCAAGCCCGCCCCCCCCTCTCACCTGCCGCCGCGCCCTCCGTCTGGCCCGCGC
GCCGACCGTGCCGACGCAGATAGAGGGACCAAGAACGGATCGGCTGTCGTCAACAAGGACGCCAACCCGCTCGGC
TCGCGTAAGCGCACCTTCGACGACGAGATTAAACCGCCCGACTACGGCCAGCTCAACAAGCTGCACATGAAGCCG
TCCAAGGGTGCCCTGGTGCCTGACTGGCAGCCCAAGCATGGCGAAGACTCTTACCCTTGGGCTACTGAACACTGC
ACTCACGGCGACAACATGGCCGTACGACTGCACAAGGAGATCATGGATTTTTACGACTTTGTCAAGCCGAGAGAG
TTCGAGCGTCGCATAAGAAGCAATCTCATCGAGAACCTCAAGGCGGCCATGAAACGCGACGGGCGTACCTTTGGC
TTGGCGCACGTGGAACCCTTCGGGTCCTTCATGTCCGGCCTCTATCTGCCGACGGCCGACATGGATCTGGTTGTC
TGCTCGCCCATGTTCATGAAGGGGGGTCCGGCCACATACCTCAGCGCAAGGAGCTGGCTCTATAAATTCTCCAAG
CTCCTCGTCGCCCAGAAGGTTGCCGACGCCGCCTCGGTGCAAGTCATCGCGCACGCGCGCATCCCTCTCGTCAAG
TTTGTCGACAAGTTGACCGGCCTCAAGGTCGACGTGTCGTTTGAGAACCGCGGCGGGGTCGAGGCCATCGATACC
TTCTTGCGATGGAAGAAAGACTACCCAGCCATGCCCATCCTCGTCACCGTCATCAAGCATTTTCTTCTCATGCGA
GGCTTGAACGAGCCCGTCAACGGCGGTATCGGCGGCTTCTCCGTCATCTGCCTCGTCGTCAGCATGCTGCAGATG
ATGCCGCAGGTGCAGAGCCGCAGCATCCACGCCCAGCATCACCTCGGCGAGCTTCTCCTGGACTTTTTCGAGCTC
TATGGCCGCCATTTTCAGTATCAGACCAATGCCATCTCTCTCACACACCCCGTCGGTTACGTTCGCAAGTCGGAT
GTTCGGACCTTCGTCTACAGAAACTCCAACCGCCTCTCCATCATTGACCCCAACAACAGCGGCAATGACATTGCG
GGCGGCTCGTCCAACACGCCCGCCATCATGGATCGATTCCACGATGCCTACCTCACTTTGCGTGACAGGATGGGA
GAGGTGGCCCGGCGCCGCGACAAGGGCCGCATCCTCGACGTGATCCTCGGTGGCAACTATTCGTCGTTCCGGATG
CAGCGAGCGTTCCTGAAGCACGTCCACGAAGAGACCGTTGGGCCATGCTCTGATGCGTAA
Transcript >Hirsu2|6706
ATGTCGCGCAACGACCCGCGCTCGTGGCGGCGCGATGACCGAGACCGCGGCAGCTCTCGCTACCGCCCATCGTCG
CCGCCGCTGCCTTCGTACGACAGCTGGCGCCCCTCGGGCAGTCGCCCGGACCGCGACCGCCGCCCCAGCGGCGAC
TCGTATCGCCAGTTCGACACGAACCGTGGCGGCGACTCGTACCGCACTGCCGACGTCTACCGCCCGTCGCTTCCC
CAGAGCAGCTTCGACTTCCGGGTCGAAAAGCCGGGCGGGATCGCGCCCATCGTCTTCCCCCCTGGCAACCAGCTG
CCCGCCGGCCCCCGCCGCGACCGTCGTGGGCCGCCGCGCGGGAAGCCGGGCCGTCGCTGGCAGCCTCCCCCTCAC
CCCTCGGAGCGAGCACTCGTCTCGGGCGATACCTATCGTCTACCCGGAGAGCGCGTCCACGACGCGGACGCCGCT
GCCAAGTTCCGCGACCTCGACGAGCTGTCGGACGACGAAGAGGTCGACATGGACATGTCGTCCTCGCGTTCCGGC
TCCCAAGATCCCGCCCCAAAGCGCGTGCGCACCGACGACAAGCCTGACGAGGCCGACGCCGTCCCCAAGTGGTCC
AACCCTGACCCCTACACTGCGCTGCCCTGTCCGGACGAGACGACGCGCAAGAAGCGCGACATGGTGAAGCTCATC
CGCAAAGCTCGCGTCGACGAGGCCAAGCCAAACACCGACACCCCTGCCCAGGCCGAGGACTTCATCTCATTCGAC
CTCTCCAGCGACGGCGAGGACACCAAGCCCGCCCCCCCCTCTCACCTGCCGCCGCGCCCTCCGTCTGGCCCGCGC
GCCGACCGTGCCGACGCAGATAGAGGGACCAAGAACGGATCGGCTGTCGTCAACAAGGACGCCAACCCGCTCGGC
TCGCGTAAGCGCACCTTCGACGACGAGATTAAACCGCCCGACTACGGCCAGCTCAACAAGCTGCACATGAAGCCG
TCCAAGGGTGCCCTGGTGCCTGACTGGCAGCCCAAGCATGGCGAAGACTCTTACCCTTGGGCTACTGAACACTGC
ACTCACGGCGACAACATGGCCGTACGACTGCACAAGGAGATCATGGATTTTTACGACTTTGTCAAGCCGAGAGAG
TTCGAGCGTCGCATAAGAAGCAATCTCATCGAGAACCTCAAGGCGGCCATGAAACGCGACGGGCGTACCTTTGGC
TTGGCGCACGTGGAACCCTTCGGGTCCTTCATGTCCGGCCTCTATCTGCCGACGGCCGACATGGATCTGGTTGTC
TGCTCGCCCATGTTCATGAAGGGGGGTCCGGCCACATACCTCAGCGCAAGGAGCTGGCTCTATAAATTCTCCAAG
CTCCTCGTCGCCCAGAAGGTTGCCGACGCCGCCTCGGTGCAAGTCATCGCGCACGCGCGCATCCCTCTCGTCAAG
TTTGTCGACAAGTTGACCGGCCTCAAGGTCGACGTGTCGTTTGAGAACCGCGGCGGGGTCGAGGCCATCGATACC
TTCTTGCGATGGAAGAAAGACTACCCAGCCATGCCCATCCTCGTCACCGTCATCAAGCATTTTCTTCTCATGCGA
GGCTTGAACGAGCCCGTCAACGGCGGTATCGGCGGCTTCTCCGTCATCTGCCTCGTCGTCAGCATGCTGCAGATG
ATGCCGCAGGTGCAGAGCCGCAGCATCCACGCCCAGCATCACCTCGGCGAGCTTCTCCTGGACTTTTTCGAGCTC
TATGGCCGCCATTTTCAGTATCAGACCAATGCCATCTCTCTCACACACCCCGTCGGTTACGTTCGCAAGTCGGAT
GTTCGGACCTTCGTCTACAGAAACTCCAACCGCCTCTCCATCATTGACCCCAACAACAGCGGCAATGACATTGCG
GGCGGCTCGTCCAACACGCCCGCCATCATGGATCGATTCCACGATGCCTACCTCACTTTGCGTGACAGGATGGGA
GAGGTGGCCCGGCGCCGCGACAAGGGCCGCATCCTCGACGTGATCCTCGGTGGCAACTATTCGTCGTTCCGGATG
CAGCGAGCGTTCCTGAAGCACGTCCACGAAGAGACCGTTGGGCCATGCTCTGATGCGTAA
Gene >Hirsu2|6706
ATGTCGCGCAACGACCCGCGCTCGTGGCGGCGCGATGACCGAGACCGCGGCAGCTCTCGCTACCGCCCATCGTCG
CCGCCGCTGCCTTCGTACGACAGCTGGCGCCCCTCGGGCAGTCGCCCGGACCGCGACCGCCGCCCCAGCGGCGAC
TCGTATCGCCAGTTCGACACGAACCGTGGCGGCGACTCGTACCGCACTGCCGACGTCTACCGCCCGTCGCTTCCC
CAGAGCAGCTTCGACTTCCGGGTCGAAAAGCCGGGCGGGATCGCGCCCATCGTCTTCCCCCCTGGCAACCAGCTG
CCCGCCGGCCCCCGCCGCGACCGTCGTGGGCCGCCGCGCGGGAAGCCGGGCCGTCGCTGGCAGCCTCCCCCTCAC
CCCTCGGAGCGAGCACTCGTCTCGGGCGATACCTATCGTCTACCCGGAGAGCGCGTCCACGACGCGGACGCCGCT
GCCAAGTTCCGCGACCTCGACGAGCTGTCGGACGACGAAGAGGTCGACATGGACATGTCGTCCTCGCGTTCCGGC
TCCCAAGATCCCGCCCCAAAGCGCGTGCGCACCGACGACAAGCCTGACGAGGCCGACGCCGTCCCCAAGTGGTCC
AACCCTGACCCCTACACTGCGCTGCCCTGTCCGGACGAGACGACGCGCAAGAAGCGCGACATGGTGAAGCTCATC
CGCAAAGCTCGCGTCGACGAGGCCAAGCCAAACACCGACACCCCTGCCCAGGCCGAGGACTTCATCTCATTCGAC
CTCTCCAGCGACGGCGAGGACACCAAGCCCGCCCCCCCCTCTCACCTGCCGCCGCGCCCTCCGTCTGGCCCGCGC
GCCGACCGTGCCGACGCAGATAGAGGGACCAAGAACGGATCGGCTGTCGTCAACAAGGACGCCAACCCGCTCGGC
TCGCGTAAGCGCACCTTCGACGACGAGATTAAACCGCCCGACTACGGCCAGCTCAACAAGCTGCACATGAAGCCG
TCCAAGGGTGCCCTGGTGCCTGACTGGCAGCCCAAGCATGGCGAAGACTCTTACCCTTGGGCTACTGAACACTGC
ACTCACGGCGACAACATGGCCGTACGGTAAGTCGCTCGCGCCGCCCCACGTCTCGGCACATGGCCTGACACTGCG
AGTCAAAACCCAAAGACTGCACAAGGAGATCATGGATTTTTACGACTTTGTCAAGCCGAGAGAGTTCGAGCGTCG
CATAAGAAGCAATCTCATCGAGAACCTCAAGGCGGCCATGAAACGCGACGGGCGTACCTTTGGCTTGGCGCACGT
GGAACCCTTCGGGTCCTTCATGTCCGGCCTCTATCTGCCGACGGCCGACATGGATCTGGTTGTCTGCTCGCCCAT
GTTCATGAAGGGGGGTCCGGCCACATACCTCAGCGCAAGGAGCTGGCTCTATAAATTCTCCAAGCTCCTCGTCGC
CCAGAAGGTTGCCGACGCCGCCTCGGTGCAAGTCATCGCGCACGCGCGCATCCCTCTCGTCAAGTTTGTCGACAA
GTTGACCGGCCTCAAGGTCGACGTGTCGTTTGAGAACCGCGGCGGGGTCGAGGCCATCGATACCTTCTTGCGATG
GAAGAAAGACTACCCAGCCATGCCCATCCTCGTCACCGTCATCAAGCATTTTCTTCTCATGCGAGGCTTGAACGA
GCCCGTCAACGGCGGTATCGGCGGCTTCTCCGTCATCTGCCTCGTCGTCAGCATGCTGCAGATGATGCCGCAGGT
GCAGAGCCGCAGCATCCACGCCCAGCATCACCTCGGCGAGCTTCTCCTGGACTTTTTCGAGCTCTATGGCCGCCA
TTTTCAGTATCAGACCAATGCCATCTCTCTCACACACCCCGTCGGTTACGTTCGCAAGGTCAGTCCGCCCCTCGG
GTCCTCGGCATCGCCTAAGCGTGCTCCAATGATTGCCGAGGCTGTCGCGGTCTGCATCCACCAGTGGCTGATTAA
GCTGTAGTCGGATGTTCGGACCTTCGTCTACAGAAACTCCAACCGCCTCTCCATCATTGACCCCAACAACAGCGG
CAATGACATTGCGGGCGGCTCGTCCAACACGCCCGCCATCATGGATCGATTCCACGATGCCTACCTCACTTTGCG
TGACAGGATGGGAGAGGTGGCCCGGCGCCGCGACAAGGGCCGCATCCTCGACGTGATCCTCGGTGGCAACTATTC
GTCGTTCCGGATGCAGCGAGCGTTCCTGAAGCACGTCCACGAAGAGACCGTTGGGCCATGCTCTGATGCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail