Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6704
Gene name
LocationContig_352:16277..17768
Strand+
Gene length (bp)1491
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01757 Acyl_transf_3 Acyltransferase family 1.3E-27 73 472

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups Yes
GO:0016746 transferase activity, transferring acyl groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 81 103 22
3 123 145 22
4 176 198 22
5 240 262 22
6 333 355 22
7 370 392 22
8 399 421 22
9 431 450 19
10 455 472 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6704
MSIPLLSLRDGLSRRSPDWLRSMPLRPMPTTTKPVTRLNACLVALLVFLLPSFVQSWLRPGPPKKRRHLHPTSWL
DGLRGVASLIVFIWHITLFHMGGNWFLWPYGIQDQNDQVPSSPIQLPFIRVIFAGTPMVHVFFVVSGYALSLKPL
KQIRKHDYEGLQRTLASSIFRRGIRLYLPVAALFTIIAILVGLGGPFAPLPVERTTVDQLLRDWLNAIITIVAIG
WDSNNQFVNVPFNPHLWTVPLEFFHSLLLFLVLAGLGRMRVRIRFLLLLGLISFCLRHDRHIAFEFLGGMALAEF
GLVQDEGRERATPTPEDGDAEDIELVATKSSSSVISITSCLATLFFLANLVVSLFLMSWPAAAEDQAPIFMTMRL
SGGSPRWFAVAAVQLVLAVQQIRILQRVFITPLVQYLGTISFSLYLVHGPVQTVTAPYFMPLLWAAVGGIEAAGV
WRRTLVWFFAVIIPLVPVVWIADVFTRTIDANSVAFARWLESQCET*
Coding >Hirsu2|6704
ATGTCGATTCCGCTGCTGTCCCTCCGCGATGGCCTCAGTCGCCGGTCCCCGGACTGGCTGCGATCCATGCCGCTG
CGTCCGATGCCGACGACGACGAAGCCGGTGACGAGGCTCAACGCCTGCCTCGTCGCCCTGCTCGTCTTCCTCCTG
CCCTCCTTCGTCCAGAGCTGGCTGCGGCCAGGCCCCCCCAAGAAGCGGCGCCACCTGCATCCGACCTCGTGGCTG
GACGGCCTTCGCGGCGTTGCCTCCTTGATCGTCTTCATCTGGCACATCACCCTCTTTCACATGGGCGGCAACTGG
TTCCTCTGGCCGTACGGCATCCAGGACCAGAACGACCAGGTGCCCTCGTCGCCCATCCAGCTTCCCTTTATCCGC
GTCATCTTCGCCGGCACCCCGATGGTCCACGTCTTCTTCGTCGTCTCCGGCTACGCCCTCTCCCTCAAGCCGCTG
AAGCAGATCAGGAAACACGACTACGAAGGCCTGCAGCGCACCCTGGCCAGCAGCATCTTCCGGCGCGGCATCCGC
CTGTACCTCCCCGTCGCGGCACTCTTCACCATCATCGCTATCCTCGTCGGCCTCGGTGGCCCGTTTGCGCCGCTC
CCGGTGGAACGAACGACCGTGGACCAGCTGCTGCGCGACTGGCTGAACGCCATCATCACCATCGTGGCCATTGGC
TGGGATTCTAACAACCAATTCGTAAACGTTCCCTTTAACCCGCATCTATGGACCGTCCCTTTGGAGTTCTTCCAC
TCCCTCCTCCTCTTCCTTGTCTTGGCTGGCCTTGGCCGCATGAGGGTACGGATTCGCTTTCTTTTGTTACTGGGC
CTCATATCTTTCTGCCTGAGACATGACCGCCATATCGCCTTTGAATTCCTCGGAGGCATGGCCCTTGCCGAGTTT
GGCCTGGTCCAGGACGAAGGCCGCGAGCGGGCGACCCCCACCCCTGAGGACGGTGACGCCGAGGATATCGAATTG
GTGGCGACCAAGTCATCCTCGAGCGTCATCAGCATCACCAGCTGCCTGGCCACGCTCTTCTTCCTGGCCAACCTC
GTCGTTAGCCTCTTCTTGATGAGTTGGCCGGCCGCCGCGGAAGACCAGGCCCCGATATTCATGACGATGCGCCTC
AGTGGCGGATCCCCGCGCTGGTTCGCTGTCGCGGCTGTCCAGCTGGTTTTAGCAGTCCAGCAGATCAGGATCCTT
CAGCGAGTCTTTATAACGCCGCTGGTGCAATACCTCGGTACTATCAGCTTCTCCCTCTACTTGGTCCACGGGCCG
GTGCAGACGGTGACGGCGCCCTACTTCATGCCGCTCCTCTGGGCTGCCGTCGGCGGCATCGAGGCGGCCGGTGTT
TGGAGACGGACGCTTGTCTGGTTCTTTGCCGTCATAATACCGTTGGTTCCGGTCGTGTGGATCGCCGACGTCTTT
ACTCGGACCATCGACGCGAATAGCGTGGCATTTGCTCGCTGGCTGGAGTCGCAGTGTGAGACCTGA
Transcript >Hirsu2|6704
ATGTCGATTCCGCTGCTGTCCCTCCGCGATGGCCTCAGTCGCCGGTCCCCGGACTGGCTGCGATCCATGCCGCTG
CGTCCGATGCCGACGACGACGAAGCCGGTGACGAGGCTCAACGCCTGCCTCGTCGCCCTGCTCGTCTTCCTCCTG
CCCTCCTTCGTCCAGAGCTGGCTGCGGCCAGGCCCCCCCAAGAAGCGGCGCCACCTGCATCCGACCTCGTGGCTG
GACGGCCTTCGCGGCGTTGCCTCCTTGATCGTCTTCATCTGGCACATCACCCTCTTTCACATGGGCGGCAACTGG
TTCCTCTGGCCGTACGGCATCCAGGACCAGAACGACCAGGTGCCCTCGTCGCCCATCCAGCTTCCCTTTATCCGC
GTCATCTTCGCCGGCACCCCGATGGTCCACGTCTTCTTCGTCGTCTCCGGCTACGCCCTCTCCCTCAAGCCGCTG
AAGCAGATCAGGAAACACGACTACGAAGGCCTGCAGCGCACCCTGGCCAGCAGCATCTTCCGGCGCGGCATCCGC
CTGTACCTCCCCGTCGCGGCACTCTTCACCATCATCGCTATCCTCGTCGGCCTCGGTGGCCCGTTTGCGCCGCTC
CCGGTGGAACGAACGACCGTGGACCAGCTGCTGCGCGACTGGCTGAACGCCATCATCACCATCGTGGCCATTGGC
TGGGATTCTAACAACCAATTCGTAAACGTTCCCTTTAACCCGCATCTATGGACCGTCCCTTTGGAGTTCTTCCAC
TCCCTCCTCCTCTTCCTTGTCTTGGCTGGCCTTGGCCGCATGAGGGTACGGATTCGCTTTCTTTTGTTACTGGGC
CTCATATCTTTCTGCCTGAGACATGACCGCCATATCGCCTTTGAATTCCTCGGAGGCATGGCCCTTGCCGAGTTT
GGCCTGGTCCAGGACGAAGGCCGCGAGCGGGCGACCCCCACCCCTGAGGACGGTGACGCCGAGGATATCGAATTG
GTGGCGACCAAGTCATCCTCGAGCGTCATCAGCATCACCAGCTGCCTGGCCACGCTCTTCTTCCTGGCCAACCTC
GTCGTTAGCCTCTTCTTGATGAGTTGGCCGGCCGCCGCGGAAGACCAGGCCCCGATATTCATGACGATGCGCCTC
AGTGGCGGATCCCCGCGCTGGTTCGCTGTCGCGGCTGTCCAGCTGGTTTTAGCAGTCCAGCAGATCAGGATCCTT
CAGCGAGTCTTTATAACGCCGCTGGTGCAATACCTCGGTACTATCAGCTTCTCCCTCTACTTGGTCCACGGGCCG
GTGCAGACGGTGACGGCGCCCTACTTCATGCCGCTCCTCTGGGCTGCCGTCGGCGGCATCGAGGCGGCCGGTGTT
TGGAGACGGACGCTTGTCTGGTTCTTTGCCGTCATAATACCGTTGGTTCCGGTCGTGTGGATCGCCGACGTCTTT
ACTCGGACCATCGACGCGAATAGCGTGGCATTTGCTCGCTGGCTGGAGTCGCAGTGTGAGACCTGA
Gene >Hirsu2|6704
ATGTCGATTCCGCTGCTGTCCCTCCGCGATGGCCTCAGTCGCCGGTCCCCGGACTGGCTGCGATCCATGCCGCTG
CGTCCGATGCCGACGACGACGAAGCCGGTGACGAGGCTCAACGCCTGCCTCGTCGCCCTGCTCGTCTTCCTCCTG
CCCTCCTTCGTCCAGAGCTGGCTGCGGCCAGGCCCCCCCAAGAAGCGGCGCCACCTGCATCCGACCTCGTGGCTG
GACGGCCTTCGCGGCGTTGCCTCCTTGATCGTCTTCATCTGGCACATCACCCTCTTTCACATGGGCGGCAACTGG
TTCCTCTGGCCGTACGGCATCCAGGACCAGAACGACCAGGTGCCCTCGTCGCCCATCCAGCTTCCCTTTATCCGC
GTCATCTTCGCCGGCACCCCGATGGTCCACGTCTTCTTCGTCGTCTCCGGCTACGCCCTCTCCCTCAAGCCGCTG
AAGCAGATCAGGAAACACGACTACGAAGGCCTGCAGCGCACCCTGGCCAGCAGCATCTTCCGGCGCGGCATCCGC
CTGTACCTCCCCGTCGCGGCACTCTTCACCATCATCGCTATCCTCGTCGGCCTCGGTGGCCCGTTTGCGCCGCTC
CCGGTGGAACGAACGACCGTGGACCAGCTGCTGCGCGACTGGCTGAACGCCATCATCACCATCGTGGCCATTGGC
TGGGATTCTAACAACCAATTCGTAAACGTTCCCTTTAACCCGCATCTATGGACCGTCCCTTTGGAGTTCTTCCAC
TCCCTCCTCCTCTTCCTTGTCTTGGCTGGCCTTGGCCGCATGAGGGTACGGATTCGCTTTCTTTTGTTACTGGGC
CTCATATCTTTCTGCCTGAGACATGACCGCCATATCGCCTTTGAATTCCTCGGAGGCATGGCCCTTGCCGAGTTT
GGCCTGGTCCAGGACGAAGGCCGCGAGCGGGCGACCCCCACCCCTGAGGACGGTGACGCCGAGGATATCGAATTG
GTGGCGACCAAGTCATCCTCGAGCGTCATCAGCATCACCAGCTGCCTGGCCACGCTCTTCTTCCTGGCCAACCTC
GTCGTTAGCCTCTTCTTGATGAGTTGGCCGGCCGCCGCGGAAGACCAGGCCCCGATATTCATGACGATGCGCCTC
AGTGGCGGATCCCCGCGCTGGTTCGCTGTCGCGGCTGTCCAGCTGGTTTTAGCAGTCCAGCAGATCAGGATCCTT
CAGCGAGTCTTTATAACGCCGCTGGTGCAATACCTCGGTACTATCAGCTTCTCCCTCTACTTGGTCCACGGGCCG
GTGCAGACGGTGACGGCGCCCTACTTCATGCCGCTCCTCTGGGCTGCCGTCGGCGGCATCGAGGCGGCCGGTGTT
TGGAGACGGACGCTTGTCTGGTTCTTTGCCGTCATAATACCGTTGGTTCCGGTCGTGTGGATCGCCGACGTCTTT
ACTCGGACCATCGACGCGAATAGCGTGGCATTTGCTCGCTGGCTGGAGTCGCAGTGTGAGACCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail