Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|670
Gene name
LocationContig_1133:6697..7646
Strand+
Gene length (bp)949
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02913 FAD-oxidase_C FAD linked oxidases, C-terminal domain 5.6E-10 59 247

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P56216|VAOX_PENSI Vanillyl-alcohol oxidase OS=Penicillium simplicissimum GN=VAOA PE=1 SV=1 1 262 2.0E-94
sp|P09788|DH4C_PSEPU 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida GN=pchF PE=1 SV=3 16 250 3.0E-23

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0003824 catalytic activity Yes
GO:0050662 coenzyme binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|670
MILQNAASLRHIALDASHYHPRSEYTASPLDVPMTEEELDAAAKKVNLGRWVYIGAVYGPEPVRKALLEVTKKEM
CKVPGSRFFHLEDRTEPHSTLHARAETMKGVPTWDELRWLKHWVPNCTFLSFSPISKVDGKVAMRQYEMAKERFR
EAKLDFFGIFSIGMREMHNVVCVVYNREDADMRRRVQWLIRTLIRDYAANGWGEFRTHIGLMDQVADTYDFNDHA
LRRLNESIKDALDPNGILAPGKSGIWPKGYDKTKWALGEDYIK*
Coding >Hirsu2|670
ATGATACTCCAGAACGCCGCCAGCCTGCGGCACATTGCCCTCGATGCCTCACATTACCACCCGCGCTCAGAGTAC
ACGGCATCGCCGCTGGACGTACCTATGACCGAAGAGGAGCTCGACGCCGCGGCAAAAAAGGTCAACCTCGGCCGC
TGGGTCTACATTGGCGCCGTATACGGGCCCGAGCCCGTGCGCAAAGCCCTACTCGAGGTCACCAAGAAGGAGATG
TGCAAGGTGCCCGGCAGCCGCTTCTTCCACCTCGAAGACCGCACGGAGCCTCATAGCACCCTGCACGCGCGCGCC
GAGACCATGAAGGGCGTCCCTACGTGGGATGAACTGCGCTGGCTAAAGCACTGGGTCCCCAACTGCACCTTTCTC
TCCTTTTCGCCCATCTCCAAGGTCGACGGCAAGGTGGCGATGCGCCAGTATGAGATGGCCAAGGAGCGCTTTCGC
GAGGCCAAGCTCGACTTTTTTGGCATCTTCAGCATCGGCATGCGCGAGATGCACAACGTCGTGTGCGTCGTTTAC
AACCGTGAGGACGCTGATATGCGCCGCCGCGTGCAGTGGCTGATACGCACCCTAATCCGCGACTACGCTGCCAAC
GGCTGGGGCGAATTCCGCACGCATATCGGCCTCATGGACCAGGTCGCCGACACGTACGACTTCAACGACCACGCA
CTGCGCCGCCTTAACGAGTCTATCAAGGACGCCCTGGACCCCAATGGAATCCTGGCCCCTGGAAAGAGTGGTATT
TGGCCCAAGGGCTATGATAAGACCAAGTGGGCCCTAGGCGAGGATTATATAAAATAA
Transcript >Hirsu2|670
ATGATACTCCAGAACGCCGCCAGCCTGCGGCACATTGCCCTCGATGCCTCACATTACCACCCGCGCTCAGAGTAC
ACGGCATCGCCGCTGGACGTACCTATGACCGAAGAGGAGCTCGACGCCGCGGCAAAAAAGGTCAACCTCGGCCGC
TGGGTCTACATTGGCGCCGTATACGGGCCCGAGCCCGTGCGCAAAGCCCTACTCGAGGTCACCAAGAAGGAGATG
TGCAAGGTGCCCGGCAGCCGCTTCTTCCACCTCGAAGACCGCACGGAGCCTCATAGCACCCTGCACGCGCGCGCC
GAGACCATGAAGGGCGTCCCTACGTGGGATGAACTGCGCTGGCTAAAGCACTGGGTCCCCAACTGCACCTTTCTC
TCCTTTTCGCCCATCTCCAAGGTCGACGGCAAGGTGGCGATGCGCCAGTATGAGATGGCCAAGGAGCGCTTTCGC
GAGGCCAAGCTCGACTTTTTTGGCATCTTCAGCATCGGCATGCGCGAGATGCACAACGTCGTGTGCGTCGTTTAC
AACCGTGAGGACGCTGATATGCGCCGCCGCGTGCAGTGGCTGATACGCACCCTAATCCGCGACTACGCTGCCAAC
GGCTGGGGCGAATTCCGCACGCATATCGGCCTCATGGACCAGGTCGCCGACACGTACGACTTCAACGACCACGCA
CTGCGCCGCCTTAACGAGTCTATCAAGGACGCCCTGGACCCCAATGGAATCCTGGCCCCTGGAAAGAGTGGTATT
TGGCCCAAGGGCTATGATAAGACCAAGTGGGCCCTAGGCGAGGATTATATAAAATAA
Gene >Hirsu2|670
ATGATACTCCAGAACGCCGCCAGCCTGCGGCACATTGCCCTCGATGCCTCACATTACCACCCGCGCTCAGAGTAC
ACGGCATCGCCGCTGGACGTACCTATGACCGAAGAGGAGCTCGACGCCGCGGCAAAAAAGGTCAACCTCGGCCGC
TGGGTCTACATTGGCGCCGTATACGGGCCCGAGCCCGTGCGCAAAGCCCTACTCGAGGTCACCAAGAAGGAGATG
TGCAAGGTGCCCGGCAGCCGCTTCTTCCACCTCGAAGACCGCACGGAGCCTCATAGCACCCTGCACGCGCGCGCC
GAGACCATGAAGGGCGTCCCTACGTGGGATGAACTGCGCTGGCTAAAGCAGTAAGTTGGTTTGCTATTCTTTTTC
TTCTCGGTTCATCGCCAGCTTGTATATCTTGCCTGACAGCTTACGCGAATACTCTCTTCAGCTGGGTCCCCAACT
GCACCTTTCTCTCCTTTTCGCCCATCTCCAAGGTCGACGGCAAGGTGGCGATGCGCCAGTATGAGATGGCCAAGG
AGCGCTTTCGCGAGGCCAAGCTCGACTTTTTTGGCATCTTCAGCATCGGCATGCGCGAGATGCGTGCGTCCTCCC
GTCTGTATCGCATTAAATTACACGGACTGACTTGAATGCCCCAGACAACGTCGTGTGCGTCGTTTACAACCGTGA
GGACGCTGATATGCGCCGCCGCGTGCAGTGGCTGATACGCACCCTAATCCGCGACTACGCTGCCAACGGCTGGGG
CGAATTCCGCACGCATATCGGCCTCATGGACCAGGTCGCCGACACGTACGACTTCAACGACCACGCACTGCGCCG
CCTTAACGAGTCTATCAAGGACGCCCTGGACCCCAATGGAATCCTGGCCCCTGGAAAGAGTGGTATTTGGCCCAA
GGGCTATGATAAGACCAAGTGGGCCCTAGGCGAGGATTATATAAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail