Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6696
Gene name
LocationContig_351:11986..12376
Strand+
Gene length (bp)390
Transcript length (bp)390
Coding sequence length (bp)390
Protein length (aa) 130

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09044 Kp4 Kp4 2.6E-26 8 118

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6696
MQLSAGSVLAALAATASGLGTNCHGSDACHSLAAAGNIQNLKAIVDNIQPRSRFYESGKQIACTGSLCAYYQNGA
HGNVDQISRHLQALLNSGCRKCGSLPTKPGSNDVSRGELKVDILAKPGCQGACL*
Coding >Hirsu2|6696
ATGCAGCTCTCGGCCGGCTCCGTCCTGGCCGCGCTGGCGGCGACGGCCTCGGGCCTGGGCACCAACTGCCACGGG
TCGGACGCGTGCCACTCGCTGGCGGCGGCCGGCAACATCCAGAACCTCAAGGCCATCGTCGACAACATCCAGCCG
CGCAGCCGGTTCTACGAGTCCGGCAAGCAGATCGCCTGCACCGGCTCGCTGTGCGCCTACTACCAGAACGGCGCC
CACGGCAACGTCGACCAGATCTCGCGCCACCTGCAGGCCCTCCTCAACAGCGGCTGCCGGAAGTGCGGCTCCCTG
CCGACCAAGCCCGGCTCCAACGACGTCAGCCGCGGCGAGCTCAAGGTCGACATCCTGGCCAAGCCCGGCTGCCAG
GGCGCCTGCCTCTGA
Transcript >Hirsu2|6696
ATGCAGCTCTCGGCCGGCTCCGTCCTGGCCGCGCTGGCGGCGACGGCCTCGGGCCTGGGCACCAACTGCCACGGG
TCGGACGCGTGCCACTCGCTGGCGGCGGCCGGCAACATCCAGAACCTCAAGGCCATCGTCGACAACATCCAGCCG
CGCAGCCGGTTCTACGAGTCCGGCAAGCAGATCGCCTGCACCGGCTCGCTGTGCGCCTACTACCAGAACGGCGCC
CACGGCAACGTCGACCAGATCTCGCGCCACCTGCAGGCCCTCCTCAACAGCGGCTGCCGGAAGTGCGGCTCCCTG
CCGACCAAGCCCGGCTCCAACGACGTCAGCCGCGGCGAGCTCAAGGTCGACATCCTGGCCAAGCCCGGCTGCCAG
GGCGCCTGCCTCTGA
Gene >Hirsu2|6696
ATGCAGCTCTCGGCCGGCTCCGTCCTGGCCGCGCTGGCGGCGACGGCCTCGGGCCTGGGCACCAACTGCCACGGG
TCGGACGCGTGCCACTCGCTGGCGGCGGCCGGCAACATCCAGAACCTCAAGGCCATCGTCGACAACATCCAGCCG
CGCAGCCGGTTCTACGAGTCCGGCAAGCAGATCGCCTGCACCGGCTCGCTGTGCGCCTACTACCAGAACGGCGCC
CACGGCAACGTCGACCAGATCTCGCGCCACCTGCAGGCCCTCCTCAACAGCGGCTGCCGGAAGTGCGGCTCCCTG
CCGACCAAGCCCGGCTCCAACGACGTCAGCCGCGGCGAGCTCAAGGTCGACATCCTGGCCAAGCCCGGCTGCCAG
GGCGCCTGCCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail