Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6695
Gene name
LocationContig_351:10509..10979
Strand-
Gene length (bp)470
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09044 Kp4 Kp4 2.1E-20 7 121

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6695
MITSLSALALLVAGAAAHGINCRGSGGCLSSDAKLSDLLVQLQQLQAQDHGRRHFRQNVQLACVQGKASSLCASY
KDGPGGSADRAVELVKELMDHGCQQCGKNPTQPGRDSTDGHLLVDVSYTPCCHGNCRCPI*
Coding >Hirsu2|6695
ATGATCACCTCCCTGTCAGCACTCGCGCTCCTCGTCGCCGGCGCGGCCGCGCACGGCATCAACTGCCGCGGCTCC
GGCGGCTGCCTGTCCAGCGACGCCAAGCTGTCCGACCTCCTGGTCCAGCTCCAGCAGCTCCAGGCGCAGGATCAC
GGCCGGCGGCACTTCAGACAGAACGTCCAGCTCGCCTGCGTCCAGGGCAAGGCTTCGTCCCTCTGCGCCTCGTAC
AAGGACGGCCCGGGCGGCTCGGCCGACCGCGCCGTCGAGCTGGTCAAGGAGCTGATGGACCACGGCTGCCAGCAG
TGCGGCAAGAATCCGACGCAGCCCGGCCGCGACAGCACCGACGGCCACCTGCTCGTCGACGTCTCCTACACGCCC
TGCTGCCACGGCAACTGCCGCTGCCCCATCTGA
Transcript >Hirsu2|6695
ATGATCACCTCCCTGTCAGCACTCGCGCTCCTCGTCGCCGGCGCGGCCGCGCACGGCATCAACTGCCGCGGCTCC
GGCGGCTGCCTGTCCAGCGACGCCAAGCTGTCCGACCTCCTGGTCCAGCTCCAGCAGCTCCAGGCGCAGGATCAC
GGCCGGCGGCACTTCAGACAGAACGTCCAGCTCGCCTGCGTCCAGGGCAAGGCTTCGTCCCTCTGCGCCTCGTAC
AAGGACGGCCCGGGCGGCTCGGCCGACCGCGCCGTCGAGCTGGTCAAGGAGCTGATGGACCACGGCTGCCAGCAG
TGCGGCAAGAATCCGACGCAGCCCGGCCGCGACAGCACCGACGGCCACCTGCTCGTCGACGTCTCCTACACGCCC
TGCTGCCACGGCAACTGCCGCTGCCCCATCTGA
Gene >Hirsu2|6695
ATGATCACCTCCCTGTCAGCACTCGCGCTCCTCGTCGCCGGCGCGGCCGCGCACGGCATCAACTGCCGCGGCTCC
GGCGGCTGCCTGTCCAGCGACGCCAAGCTGTCCGACCTCCTGGTCCAGCTCCAGCAGCTCCAGGCGCAGGATCAC
GGCCGGCGGCACTTCAGACAGAACGGTGAGAGAGCCCTCCTATGCTCCGTCTACGTGCCGCGCGCGCTCACATCT
CTCTCTGTGTAGTCCAGCTCGCCTGCGTCCAGGGCAAGGCTTCGTCCCTCTGCGCCTCGTACAAGGACGGCCCGG
GCGGCTCGGCCGACCGCGCCGTCGAGCTGGTCAAGGAGCTGATGGACCACGGCTGCCAGCAGTGCGGCAAGAATC
CGACGCAGCCCGGCCGCGACAGCACCGACGGCCACCTGCTCGTCGACGTCTCCTACACGCCCTGCTGCCACGGCA
ACTGCCGCTGCCCCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail