Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6694
Gene name
LocationContig_351:8442..10149
Strand+
Gene length (bp)1707
Transcript length (bp)1602
Coding sequence length (bp)1602
Protein length (aa) 534

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.6E-39 81 372
PF00083 Sugar_tr Sugar (and other) transporter 4.1E-08 112 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 31 529 8.0E-60
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 19 533 7.0E-56
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 40 502 8.0E-53
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 30 532 1.0E-50
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 49 506 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 31 529 8.0E-60
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 19 533 7.0E-56
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 40 502 8.0E-53
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 30 532 1.0E-50
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 49 506 2.0E-42
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 68 257 5.0E-28
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 13 504 2.0E-27
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 9 263 8.0E-24
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 84 509 8.0E-21
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 93 526 3.0E-18
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 85 253 3.0E-18
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 93 526 7.0E-18
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 74 490 9.0E-18
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 82 526 1.0E-17
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 89 380 2.0E-15
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 17 524 6.0E-14
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 72 256 2.0E-13
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 71 261 4.0E-12
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 65 233 4.0E-12
sp|P77726|YAJR_ECOLI Inner membrane transport protein YajR OS=Escherichia coli (strain K12) GN=yajR PE=1 SV=2 82 262 5.0E-12
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 87 253 9.0E-12
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 85 257 1.0E-11
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 93 253 2.0E-10
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 93 253 2.0E-10
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 93 253 3.0E-10
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 91 369 3.0E-10
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 114 386 4.0E-10
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 91 364 5.0E-10
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 93 253 5.0E-10
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 48 480 6.0E-10
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 48 480 6.0E-10
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 93 253 8.0E-10
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 93 253 8.0E-10
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 93 253 8.0E-10
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 93 253 8.0E-10
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 93 253 8.0E-10
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 93 253 8.0E-10
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 93 253 8.0E-10
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 93 253 8.0E-10
sp|Q9ZCV6|BCRH_RICPR Uncharacterized transporter RP603 OS=Rickettsia prowazekii (strain Madrid E) GN=RP603 PE=3 SV=1 113 257 9.0E-10
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 93 253 9.0E-10
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 93 253 9.0E-10
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 93 253 9.0E-10
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 93 253 9.0E-10
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 93 253 9.0E-10
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 93 253 9.0E-10
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 93 253 9.0E-10
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 93 253 9.0E-10
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 93 253 9.0E-10
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 93 253 9.0E-10
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 93 253 1.0E-09
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 93 253 1.0E-09
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 93 253 1.0E-09
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 3 386 1.0E-09
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 93 253 1.0E-09
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 93 253 1.0E-09
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 93 253 1.0E-09
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 93 253 2.0E-09
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 82 379 2.0E-09
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 91 255 9.0E-09
sp|A0L190|MDTL_SHESA Multidrug resistance protein MdtL OS=Shewanella sp. (strain ANA-3) GN=mdtL PE=3 SV=1 93 253 1.0E-08
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 25 388 1.0E-08
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 81 256 1.0E-08
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 133 363 2.0E-08
sp|Q68WD6|BCRH_RICTY Uncharacterized transporter RT0591 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0591 PE=3 SV=1 113 257 3.0E-08
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 2 479 5.0E-08
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 341 525 9.0E-08
sp|Q8EA87|MDTL_SHEON Multidrug resistance protein MdtL OS=Shewanella oneidensis (strain MR-1) GN=mdtL PE=3 SV=1 93 253 1.0E-07
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 69 237 1.0E-07
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 114 388 2.0E-07
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 113 374 2.0E-07
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 93 257 2.0E-07
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 93 257 2.0E-07
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 93 257 2.0E-07
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 93 233 2.0E-07
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 93 233 2.0E-07
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 93 233 2.0E-07
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 93 233 2.0E-07
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 93 257 3.0E-07
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 93 257 3.0E-07
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 114 388 3.0E-07
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 90 253 4.0E-07
sp|O24723|PHDT_NOCSK Probable 1-hydroxy-2-naphthoate transporter OS=Nocardioides sp. (strain KP7) PE=3 SV=1 100 371 4.0E-07
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 73 255 4.0E-07
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 73 255 4.0E-07
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 93 253 4.0E-07
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 93 253 4.0E-07
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 93 253 4.0E-07
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 93 233 4.0E-07
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 93 253 6.0E-07
sp|P57538|Y466_BUCAI Uncharacterized transporter BU466 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=BU466 PE=3 SV=1 98 258 6.0E-07
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 124 258 1.0E-06
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 93 233 2.0E-06
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 131 244 4.0E-06
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 93 270 4.0E-06
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 93 233 6.0E-06
sp|A8AGR7|SOTB_CITK8 Probable sugar efflux transporter OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=sotB PE=3 SV=1 90 252 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 74 96 22
2 137 159 22
3 166 188 22
4 203 225 22
5 232 250 18
6 312 331 19
7 348 370 22
8 405 427 22
9 434 456 22
10 493 515 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6694
MKQTAVETAGEADAATKHQHHPPSPEPAGAETTSKQAAADVAGPRSPGDESREEAAAEPELQPLHSVFSGRTRVF
VIGMTVFGSLFSPFSSFIYLPAITPIADEYGRPVGDINLSVTVYQVMQALAPLFFGDLSDQIGRRPVYAMTFAVY
LGANVGLALQRRYPALMALRALQSTGSSATVAVGSAVVADLATSAERGGYMTAVQASLMFAPALAPVVGGLLTQF
LGWRSTFWFLAIAAALFLALYLPFVPETARNVVGDGSVPPPKLNASVVSCVRRRDPEPCRGPKTTSGFKVPVPNL
LAAVRIVFEKDVGLLMLFMSLFVMANYAMLVPLQDVIRRRYGFNDLQVGLCYIPFSVGSVIGAAAVGRLLDWNYA
RVARQLGLSPDRKRGQDLRRFPIERARLDLMWPWTLLAFATIAVWGWVVSAGTSLAAPLIILFLAGLGLSGPVSI
LTTLLVDLYPMNPGRVSSSFNLTRATLSAVGTGVVQYIIDAWGYGFTYLFLALVVLAASPSVAVVRRWGPKWREE
RYQRFERS*
Coding >Hirsu2|6694
ATGAAGCAGACGGCGGTCGAAACGGCGGGAGAAGCAGACGCGGCGACGAAGCATCAGCACCATCCGCCCTCGCCG
GAGCCGGCCGGCGCAGAGACGACAAGCAAGCAGGCGGCAGCCGACGTGGCCGGGCCCCGAAGCCCGGGGGACGAG
AGCCGGGAGGAGGCCGCTGCCGAGCCGGAGCTCCAGCCGCTGCACTCCGTCTTCTCCGGCCGGACCAGGGTGTTC
GTCATCGGCATGACCGTCTTCGGCTCGCTCTTCTCGCCCTTCTCCTCCTTCATCTACCTGCCGGCCATCACGCCG
ATCGCGGACGAGTACGGCCGGCCGGTGGGCGACATCAACCTCAGCGTGACGGTGTACCAGGTGATGCAGGCGCTG
GCGCCGCTCTTCTTCGGCGACCTGAGCGACCAGATCGGCCGGCGGCCCGTCTACGCCATGACCTTCGCCGTCTAC
CTCGGCGCCAACGTCGGGCTGGCCCTGCAGCGGCGCTACCCGGCCCTCATGGCGCTGCGCGCGCTGCAGAGCACG
GGCAGCAGCGCGACCGTGGCCGTCGGCAGCGCCGTCGTCGCCGACCTGGCCACCAGCGCCGAGAGGGGCGGCTAC
ATGACGGCCGTCCAGGCGAGCCTCATGTTTGCCCCGGCCCTGGCCCCGGTCGTCGGCGGCCTCCTGACCCAGTTC
CTCGGCTGGCGCTCGACCTTTTGGTTCCTCGCCATCGCCGCCGCCCTCTTCCTCGCCCTCTACCTGCCCTTTGTG
CCCGAGACGGCTCGCAACGTCGTCGGCGACGGGTCGGTGCCGCCTCCGAAGCTCAACGCCTCGGTCGTGTCCTGC
GTCCGGCGCCGCGATCCGGAGCCGTGCCGGGGGCCGAAGACGACGTCCGGCTTCAAGGTGCCGGTGCCCAACTTG
CTGGCGGCCGTGCGCATCGTGTTCGAAAAGGACGTCGGCTTGCTCATGCTCTTCATGTCGCTCTTCGTCATGGCC
AACTACGCCATGCTCGTCCCGCTGCAGGACGTGATCCGGCGGCGGTACGGCTTCAACGACCTCCAGGTCGGCCTC
TGCTACATCCCCTTCTCCGTCGGCTCCGTCATCGGCGCCGCCGCCGTCGGCCGCCTGCTCGACTGGAACTACGCC
CGCGTGGCCCGGCAGCTGGGCCTGTCGCCGGACCGCAAGCGAGGCCAGGACCTGCGCCGCTTCCCGATCGAGCGG
GCCCGGCTGGACCTGATGTGGCCGTGGACGCTGCTCGCCTTCGCCACCATCGCCGTCTGGGGCTGGGTCGTCAGC
GCCGGCACCAGCCTCGCCGCGCCGCTCATCATCCTCTTCCTCGCCGGCCTGGGCCTGAGCGGGCCCGTCTCCATC
CTGACGACGCTGCTGGTCGACCTCTATCCCATGAACCCGGGCCGCGTCTCGTCCTCGTTCAACCTGACGAGGGCG
ACGCTGAGTGCGGTCGGGACGGGCGTTGTGCAGTACATCATCGACGCCTGGGGCTACGGCTTCACCTATCTCTTC
CTGGCGCTTGTCGTGCTGGCCGCCTCGCCCAGCGTGGCCGTCGTGCGGCGATGGGGTCCCAAGTGGAGAGAAGAG
AGGTATCAGCGCTTCGAGCGGAGCTGA
Transcript >Hirsu2|6694
ATGAAGCAGACGGCGGTCGAAACGGCGGGAGAAGCAGACGCGGCGACGAAGCATCAGCACCATCCGCCCTCGCCG
GAGCCGGCCGGCGCAGAGACGACAAGCAAGCAGGCGGCAGCCGACGTGGCCGGGCCCCGAAGCCCGGGGGACGAG
AGCCGGGAGGAGGCCGCTGCCGAGCCGGAGCTCCAGCCGCTGCACTCCGTCTTCTCCGGCCGGACCAGGGTGTTC
GTCATCGGCATGACCGTCTTCGGCTCGCTCTTCTCGCCCTTCTCCTCCTTCATCTACCTGCCGGCCATCACGCCG
ATCGCGGACGAGTACGGCCGGCCGGTGGGCGACATCAACCTCAGCGTGACGGTGTACCAGGTGATGCAGGCGCTG
GCGCCGCTCTTCTTCGGCGACCTGAGCGACCAGATCGGCCGGCGGCCCGTCTACGCCATGACCTTCGCCGTCTAC
CTCGGCGCCAACGTCGGGCTGGCCCTGCAGCGGCGCTACCCGGCCCTCATGGCGCTGCGCGCGCTGCAGAGCACG
GGCAGCAGCGCGACCGTGGCCGTCGGCAGCGCCGTCGTCGCCGACCTGGCCACCAGCGCCGAGAGGGGCGGCTAC
ATGACGGCCGTCCAGGCGAGCCTCATGTTTGCCCCGGCCCTGGCCCCGGTCGTCGGCGGCCTCCTGACCCAGTTC
CTCGGCTGGCGCTCGACCTTTTGGTTCCTCGCCATCGCCGCCGCCCTCTTCCTCGCCCTCTACCTGCCCTTTGTG
CCCGAGACGGCTCGCAACGTCGTCGGCGACGGGTCGGTGCCGCCTCCGAAGCTCAACGCCTCGGTCGTGTCCTGC
GTCCGGCGCCGCGATCCGGAGCCGTGCCGGGGGCCGAAGACGACGTCCGGCTTCAAGGTGCCGGTGCCCAACTTG
CTGGCGGCCGTGCGCATCGTGTTCGAAAAGGACGTCGGCTTGCTCATGCTCTTCATGTCGCTCTTCGTCATGGCC
AACTACGCCATGCTCGTCCCGCTGCAGGACGTGATCCGGCGGCGGTACGGCTTCAACGACCTCCAGGTCGGCCTC
TGCTACATCCCCTTCTCCGTCGGCTCCGTCATCGGCGCCGCCGCCGTCGGCCGCCTGCTCGACTGGAACTACGCC
CGCGTGGCCCGGCAGCTGGGCCTGTCGCCGGACCGCAAGCGAGGCCAGGACCTGCGCCGCTTCCCGATCGAGCGG
GCCCGGCTGGACCTGATGTGGCCGTGGACGCTGCTCGCCTTCGCCACCATCGCCGTCTGGGGCTGGGTCGTCAGC
GCCGGCACCAGCCTCGCCGCGCCGCTCATCATCCTCTTCCTCGCCGGCCTGGGCCTGAGCGGGCCCGTCTCCATC
CTGACGACGCTGCTGGTCGACCTCTATCCCATGAACCCGGGCCGCGTCTCGTCCTCGTTCAACCTGACGAGGGCG
ACGCTGAGTGCGGTCGGGACGGGCGTTGTGCAGTACATCATCGACGCCTGGGGCTACGGCTTCACCTATCTCTTC
CTGGCGCTTGTCGTGCTGGCCGCCTCGCCCAGCGTGGCCGTCGTGCGGCGATGGGGTCCCAAGTGGAGAGAAGAG
AGGTATCAGCGCTTCGAGCGGAGCTGA
Gene >Hirsu2|6694
ATGAAGCAGACGGCGGTCGAAACGGCGGGAGAAGCAGACGCGGCGACGAAGCATCAGCACCATCCGCCCTCGCCG
GAGCCGGCCGGCGCAGAGACGACAAGCAAGCAGGCGGCAGCCGACGTGGCCGGGCCCCGAAGCCCGGGGGACGAG
AGCCGGGAGGAGGCCGCTGCCGAGCCGGAGCTCCAGCCGCTGCACTCCGTCTTCTCCGGCCGGACCAGGGTGTTC
GTCATCGGCATGACCGTCTTCGGCTCGCTCTTCTCGCCCTTCTCCTCCTTCATCTACCTGCCGGCCATCACGCCG
ATCGCGGACGAGTACGGCCGGCCGGTGGGCGACATCAACCTCAGCGTGACGGTGTACCAGGTGATGCAGGCGCTG
GCGCCGCTCTTCTTCGGCGACCTGAGCGACCAGATCGGCCGGCGGCCCGTCTACGCCATGACCTTCGCCGTCTAC
CTCGGCGCCAACGTCGGGCTGGCCCTGCAGCGGCGCTACCCGGCCCTCATGGCGCTGCGCGCGCTGCAGAGCACG
GGCAGCAGCGCGACCGTGGCCGTCGGCAGCGCCGTCGTCGCCGACCTGGCCACCAGCGCCGAGAGGGGCGGCTAC
ATGACGGCCGTCCAGGCGAGCCTCATGTTTGCCCCGGCCCTGGCCCCGGTCGTCGGCGGCCTCCTGACCCAGTTC
CTCGGCTGGCGCTCGACCTTTTGGTTCCTCGCCATCGCCGCCGCCCTCTTCCTCGCCCTCTACCTGCCCTTTGTG
CCCGAGGTATGCCGCCGTCTCCTTTCCCCCATCTCGCCGGCTCGCTGCTTGGATCGTGGCGAGCTCCGGCGGCGG
CGGCAGGCGGGCAGGCTGTGGCTGACTCGGATGTAGACGGCTCGCAACGTCGTCGGCGACGGGTCGGTGCCGCCT
CCGAAGCTCAACGCCTCGGTCGTGTCCTGCGTCCGGCGCCGCGATCCGGAGCCGTGCCGGGGGCCGAAGACGACG
TCCGGCTTCAAGGTGCCGGTGCCCAACTTGCTGGCGGCCGTGCGCATCGTGTTCGAAAAGGACGTCGGCTTGCTC
ATGCTCTTCATGTCGCTCTTCGTCATGGCCAACTACGCCATGCTCGTCCCGCTGCAGGACGTGATCCGGCGGCGG
TACGGCTTCAACGACCTCCAGGTCGGCCTCTGCTACATCCCCTTCTCCGTCGGCTCCGTCATCGGCGCCGCCGCC
GTCGGCCGCCTGCTCGACTGGAACTACGCCCGCGTGGCCCGGCAGCTGGGCCTGTCGCCGGACCGCAAGCGAGGC
CAGGACCTGCGCCGCTTCCCGATCGAGCGGGCCCGGCTGGACCTGATGTGGCCGTGGACGCTGCTCGCCTTCGCC
ACCATCGCCGTCTGGGGCTGGGTCGTCAGCGCCGGCACCAGCCTCGCCGCGCCGCTCATCATCCTCTTCCTCGCC
GGCCTGGGCCTGAGCGGGCCCGTCTCCATCCTGACGACGCTGCTGGTCGACCTCTATCCCATGAACCCGGGCCGC
GTCTCGTCCTCGTTCAACCTGACGAGGGCGACGCTGAGTGCGGTCGGGACGGGCGTTGTGCAGTACATCATCGAC
GCCTGGGGCTACGGCTTCACCTATCTCTTCCTGGCGCTTGTCGTGCTGGCCGCCTCGCCCAGCGTGGCCGTCGTG
CGGCGATGGGGTCCCAAGTGGAGAGAAGAGAGGTATCAGCGCTTCGAGCGGAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail