Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|669
Gene name
LocationContig_1133:5632..6475
Strand+
Gene length (bp)843
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.4E-24 81 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56216|VAOX_PENSI Vanillyl-alcohol oxidase OS=Penicillium simplicissimum GN=VAOA PE=1 SV=1 16 279 8.0E-89
sp|P09788|DH4C_PSEPU 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida GN=pchF PE=1 SV=3 18 279 8.0E-53
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 81 221 3.0E-12
sp|P77748|YDIJ_ECOLI Uncharacterized protein YdiJ OS=Escherichia coli (strain K12) GN=ydiJ PE=3 SV=1 76 220 4.0E-09
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 82 235 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56216|VAOX_PENSI Vanillyl-alcohol oxidase OS=Penicillium simplicissimum GN=VAOA PE=1 SV=1 16 279 8.0E-89
sp|P09788|DH4C_PSEPU 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida GN=pchF PE=1 SV=3 18 279 8.0E-53
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 81 221 3.0E-12
sp|P77748|YDIJ_ECOLI Uncharacterized protein YdiJ OS=Escherichia coli (strain K12) GN=ydiJ PE=3 SV=1 76 220 4.0E-09
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 82 235 2.0E-08
sp|P9WIT1|Y2280_MYCTU Uncharacterized FAD-linked oxidoreductase Rv2280 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2280 PE=1 SV=1 85 221 1.0E-07
sp|P9WIT0|Y2280_MYCTO Uncharacterized FAD-linked oxidoreductase MT2338 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2338 PE=3 SV=1 85 221 1.0E-07
sp|Q57252|Y1163_HAEIN Uncharacterized protein HI_1163 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1163 PE=1 SV=1 81 220 2.0E-06
sp|Q12627|DLD1_KLULA D-lactate dehydrogenase [cytochrome], mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DLD1 PE=3 SV=2 82 230 2.0E-06
sp|Q86WU2|LDHD_HUMAN Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens GN=LDHD PE=1 SV=1 29 221 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|669
MAAHVETTDPAAVPLPRCLPPGFTADRFRVFVPRLAGVVGRENVTVIGADMPLDDGDYQTVDCLTHDMHFLYDRG
EFVGSAITFPRSAGEVQAVVSLCNELGMPIWTVSRGHNIGYGGAAPRVPGSLVLNMGRHMNRILEVNADECWCLL
EPGVSYIQLYEYLAERGLQDRLWLDSPELGFGSVIGNALDHGVGFTPYGDHWMVHCGMEVVLANGDIVRTGMGAM
SSPEGRQQAREGVAPVDQKPNDHWQLFPYGFGPITDGLFSMSNNGIVTKMGMWVS*
Coding >Hirsu2|669
ATGGCAGCTCACGTCGAGACGACAGACCCGGCCGCGGTACCCCTGCCGCGGTGCCTGCCGCCTGGCTTCACCGCC
GATAGGTTCCGAGTCTTTGTGCCGCGCCTGGCCGGTGTGGTGGGCCGAGAAAACGTCACTGTCATCGGCGCCGAC
ATGCCGCTCGACGACGGCGACTACCAGACAGTGGATTGCTTGACCCACGACATGCACTTCCTTTACGACCGTGGC
GAGTTCGTCGGCAGCGCGATTACCTTCCCGCGCTCCGCCGGAGAGGTCCAGGCCGTCGTAAGCTTGTGCAACGAG
CTAGGGATGCCCATCTGGACCGTCAGCAGGGGCCACAATATCGGCTACGGTGGCGCGGCCCCCCGCGTCCCGGGC
AGCCTGGTGCTCAACATGGGCCGCCACATGAACCGCATCCTCGAGGTCAACGCGGACGAGTGCTGGTGCCTGCTG
GAGCCGGGCGTCTCCTACATCCAGCTGTACGAGTACCTGGCCGAGCGAGGCCTTCAGGACCGGCTGTGGCTCGAC
AGCCCCGAGCTGGGGTTCGGGTCCGTCATCGGCAATGCGCTGGATCACGGCGTCGGCTTCACACCATACGGCGAC
CACTGGATGGTTCACTGTGGCATGGAAGTCGTGCTTGCAAACGGCGACATCGTCCGCACCGGCATGGGCGCCATG
TCCAGCCCCGAGGGCCGTCAGCAGGCACGAGAAGGCGTGGCGCCGGTCGATCAGAAACCGAACGATCACTGGCAG
CTGTTCCCGTATGGCTTCGGGCCAATCACGGACGGCCTCTTTTCCATGAGTAACAACGGCATCGTTACCAAGATG
GGCATGTGGGTGAGTTGA
Transcript >Hirsu2|669
ATGGCAGCTCACGTCGAGACGACAGACCCGGCCGCGGTACCCCTGCCGCGGTGCCTGCCGCCTGGCTTCACCGCC
GATAGGTTCCGAGTCTTTGTGCCGCGCCTGGCCGGTGTGGTGGGCCGAGAAAACGTCACTGTCATCGGCGCCGAC
ATGCCGCTCGACGACGGCGACTACCAGACAGTGGATTGCTTGACCCACGACATGCACTTCCTTTACGACCGTGGC
GAGTTCGTCGGCAGCGCGATTACCTTCCCGCGCTCCGCCGGAGAGGTCCAGGCCGTCGTAAGCTTGTGCAACGAG
CTAGGGATGCCCATCTGGACCGTCAGCAGGGGCCACAATATCGGCTACGGTGGCGCGGCCCCCCGCGTCCCGGGC
AGCCTGGTGCTCAACATGGGCCGCCACATGAACCGCATCCTCGAGGTCAACGCGGACGAGTGCTGGTGCCTGCTG
GAGCCGGGCGTCTCCTACATCCAGCTGTACGAGTACCTGGCCGAGCGAGGCCTTCAGGACCGGCTGTGGCTCGAC
AGCCCCGAGCTGGGGTTCGGGTCCGTCATCGGCAATGCGCTGGATCACGGCGTCGGCTTCACACCATACGGCGAC
CACTGGATGGTTCACTGTGGCATGGAAGTCGTGCTTGCAAACGGCGACATCGTCCGCACCGGCATGGGCGCCATG
TCCAGCCCCGAGGGCCGTCAGCAGGCACGAGAAGGCGTGGCGCCGGTCGATCAGAAACCGAACGATCACTGGCAG
CTGTTCCCGTATGGCTTCGGGCCAATCACGGACGGCCTCTTTTCCATGAGTAACAACGGCATCGTTACCAAGATG
GGCATGTGGGTGAGTTGA
Gene >Hirsu2|669
ATGGCAGCTCACGTCGAGACGACAGACCCGGCCGCGGTACCCCTGCCGCGGTGCCTGCCGCCTGGCTTCACCGCC
GATAGGTTCCGAGTCTTTGTGCCGCGCCTGGCCGGTGTGGTGGGCCGAGAAAACGTCACTGTCATCGGCGCCGAC
ATGCCGCTCGACGACGGCGACTACCAGACAGTGGATTGCTTGACCCACGACATGCACTTCCTTTACGACCGTGGC
GAGTTCGTCGGCAGCGCGATTACCTTCCCGCGCTCCGCCGGAGAGGTCCAGGCCGTCGTAAGCTTGTGCAACGAG
CTAGGGATGCCCATCTGGACCGTCAGCAGGGGCCACAATATCGGCTACGGTGGCGCGGCCCCCCGCGTCCCGGGC
AGCCTGGTGCTCAACATGGGCCGCCACATGAACCGCATCCTCGAGGTCAACGCGGACGAGTGCTGGTGCCTGCTG
GAGCCGGGCGTCTCCTACATCCAGCTGTACGAGTACCTGGCCGAGCGAGGCCTTCAGGACCGGCTGTGGCTCGAC
AGCCCCGAGCTGGGGTTCGGGTCCGTCATCGGCAATGCGCTGGATCACGGCGTCGGCTTCACACCATACGGCGAC
CACTGGATGGTTCACTGTGGCATGGAAGTCGTGCTTGCAAACGGCGACATCGTCCGCACCGGCATGGGCGCCATG
TCCAGCCCCGAGGGCCGTCAGCAGGCACGAGAAGGCGTGGCGCCGGTCGATCAGAAACCGAACGATCACTGGCAG
CTGTTCCCGTATGGCTTCGGGCCAATCACGGACGGCCTCTTTTCCATGAGTAACAACGGCATCGTTACCAAGATG
GGCATGTGGGTGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail