Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6684
Gene name
LocationContig_35:53669..57465
Strand+
Gene length (bp)3796
Transcript length (bp)3375
Coding sequence length (bp)3375
Protein length (aa) 1125

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 2.6E-224 148 770
PF08264 Anticodon_1 Anticodon-binding domain of tRNA 7.9E-32 814 962
PF09334 tRNA-synt_1g tRNA synthetases class I (M) 7.2E-06 179 327
PF13603 tRNA-synt_1_2 Leucyl-tRNA synthetase, Domain 2 1.0E-09 396 454
PF10458 Val_tRNA-synt_C Valyl tRNA synthetase tRNA binding arm 6.9E-08 1026 1085

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28350|SYV_NEUCR Valine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-20 PE=1 SV=1 105 1093 0.0E+00
sp|P07806|SYV_YEAST Valine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAS1 PE=1 SV=2 109 1093 0.0E+00
sp|O75005|SYV_SCHPO Valine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vas2 PE=3 SV=1 45 989 0.0E+00
sp|P49696|SYVC_TAKRU Valine--tRNA ligase OS=Takifugu rubripes GN=vars PE=3 SV=1 66 1093 0.0E+00
sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens GN=VARS PE=1 SV=4 47 1093 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28350|SYV_NEUCR Valine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-20 PE=1 SV=1 105 1093 0.0E+00
sp|P07806|SYV_YEAST Valine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAS1 PE=1 SV=2 109 1093 0.0E+00
sp|O75005|SYV_SCHPO Valine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vas2 PE=3 SV=1 45 989 0.0E+00
sp|P49696|SYVC_TAKRU Valine--tRNA ligase OS=Takifugu rubripes GN=vars PE=3 SV=1 66 1093 0.0E+00
sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens GN=VARS PE=1 SV=4 47 1093 0.0E+00
sp|Q9Z1Q9|SYVC_MOUSE Valine--tRNA ligase OS=Mus musculus GN=Vars PE=1 SV=1 66 1093 0.0E+00
sp|Q04462|SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus GN=Vars PE=2 SV=2 66 1093 0.0E+00
sp|Q9U1Q4|SYV_CAEEL Valine--tRNA ligase OS=Caenorhabditis elegans GN=vrs-2 PE=1 SV=1 98 1093 0.0E+00
sp|Q86KU2|SYVC_DICDI Probable valine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=valS1 PE=3 SV=1 72 1093 0.0E+00
sp|P93736|SYVM1_ARATH Valine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana GN=TWN2 PE=2 SV=2 71 1083 0.0E+00
sp|Q3U2A8|SYVM_MOUSE Valine--tRNA ligase, mitochondrial OS=Mus musculus GN=Vars2 PE=1 SV=2 57 1054 0.0E+00
sp|Q6MG21|SYVM_RAT Valine--tRNA ligase, mitochondrial OS=Rattus norvegicus GN=Vars2 PE=3 SV=1 57 1085 0.0E+00
sp|Q767M3|SYVM_PIG Valine--tRNA ligase, mitochondrial OS=Sus scrofa GN=VARS2 PE=3 SV=1 73 1052 0.0E+00
sp|Q3SL86|SYV_THIDA Valine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=valS PE=3 SV=1 137 1075 0.0E+00
sp|Q606C1|SYV_METCA Valine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=valS PE=3 SV=1 137 1075 0.0E+00
sp|Q5ST30|SYVM_HUMAN Valine--tRNA ligase, mitochondrial OS=Homo sapiens GN=VARS2 PE=1 SV=2 73 1050 0.0E+00
sp|Q4KHT9|SYV_PSEF5 Valine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=valS PE=3 SV=1 137 1078 0.0E+00
sp|Q3JC50|SYV_NITOC Valine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=valS PE=3 SV=1 137 1089 0.0E+00
sp|Q5TM74|SYVM_MACMU Valine--tRNA ligase, mitochondrial OS=Macaca mulatta GN=VARS2 PE=3 SV=2 73 1050 0.0E+00
sp|Q0VSA8|SYV_ALCBS Valine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q9HXH0|SYV_PSEAE Valine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=valS PE=1 SV=1 137 1078 0.0E+00
sp|Q9CMK5|SYV_PASMU Valine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=valS PE=3 SV=1 135 1075 0.0E+00
sp|Q6F8F0|SYV_ACIAD Valine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q88P76|SYV_PSEPK Valine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q887M3|SYV_PSESM Valine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=valS PE=3 SV=1 137 1078 0.0E+00
sp|Q48MF2|SYV_PSE14 Valine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=valS PE=3 SV=1 137 1078 0.0E+00
sp|Q3A253|SYV_PELCD Valine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=valS PE=3 SV=1 137 1079 0.0E+00
sp|Q4ZXI0|SYV_PSEU2 Valine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=valS PE=3 SV=1 137 1078 0.0E+00
sp|Q5ZXL2|SYV_LEGPH Valine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q5X728|SYV_LEGPA Valine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q5WYI0|SYV_LEGPL Valine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q2YB22|SYV_NITMU Valine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=valS PE=3 SV=1 137 1074 0.0E+00
sp|P43834|SYV_HAEIN Valine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=valS PE=3 SV=1 139 1089 0.0E+00
sp|Q7MZ25|SYV_PHOLL Valine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=valS PE=3 SV=1 117 1084 0.0E+00
sp|Q4QKA4|SYV_HAEI8 Valine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=valS PE=3 SV=1 139 1089 0.0E+00
sp|Q5NHZ4|SYV_FRATT Valine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=valS PE=3 SV=1 137 1074 0.0E+00
sp|Q8EBS5|SYV_SHEON Valine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q66F11|SYV_YERPS Valine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=valS PE=3 SV=1 117 1085 0.0E+00
sp|A5UEN9|SYV_HAEIG Valine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=valS PE=3 SV=1 139 1089 0.0E+00
sp|Q97GG8|SYV_CLOAB Valine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=valS PE=3 SV=1 128 1072 0.0E+00
sp|B0BR94|SYV_ACTPJ Valine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=valS PE=3 SV=1 139 1088 0.0E+00
sp|A3N2F0|SYV_ACTP2 Valine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=valS PE=3 SV=1 139 1088 0.0E+00
sp|Q65S97|SYV_MANSM Valine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=valS PE=3 SV=1 139 1088 0.0E+00
sp|Q8ZBH1|SYV_YERPE Valine--tRNA ligase OS=Yersinia pestis GN=valS PE=3 SV=1 117 1085 0.0E+00
sp|B3GYI3|SYV_ACTP7 Valine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=valS PE=3 SV=1 139 1088 0.0E+00
sp|Q6DA54|SYV_PECAS Valine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=valS PE=3 SV=1 139 1073 0.0E+00
sp|Q9KP73|SYV_VIBCH Valine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q891R5|SYV_CLOTE Valine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=valS PE=3 SV=1 137 1090 0.0E+00
sp|Q3AF87|SYV_CARHZ Valine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=valS PE=3 SV=1 138 1087 0.0E+00
sp|A5UBZ9|SYV_HAEIE Valine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=valS PE=3 SV=1 139 1089 0.0E+00
sp|Q67SJ2|SYV_SYMTH Valine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|Q47BG6|SYV_DECAR Valine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=valS PE=3 SV=1 137 1077 0.0E+00
sp|Q83DD0|SYV_COXBU Valine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=valS PE=3 SV=1 137 1086 0.0E+00
sp|Q62KW5|SYV_BURMA Valine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=valS PE=3 SV=1 137 1075 0.0E+00
sp|Q8RBN5|SYV_CALS4 Valine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=valS PE=3 SV=1 137 1087 0.0E+00
sp|Q488M6|SYV_COLP3 Valine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q63TI8|SYV_BURPS Valine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=valS PE=3 SV=1 137 1075 0.0E+00
sp|Q474E1|SYV_CUPPJ Valine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=valS PE=3 SV=1 137 1078 0.0E+00
sp|Q82X51|SYV_NITEU Valine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=valS PE=3 SV=1 137 1092 0.0E+00
sp|Q87LG6|SYV_VIBPA Valine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=valS PE=3 SV=1 137 1092 0.0E+00
sp|Q5NXL5|SYV_AROAE Valine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q57GC5|SYV_SALCH Valine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=valS PE=3 SV=1 137 1084 0.0E+00
sp|Q5PJB8|SYV_SALPA Valine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=valS PE=3 SV=1 137 1084 0.0E+00
sp|B0USP0|SYV_HISS2 Valine--tRNA ligase OS=Histophilus somni (strain 2336) GN=valS PE=3 SV=1 139 1092 0.0E+00
sp|Q8RHK3|SYV_FUSNN Valine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=valS PE=3 SV=1 137 1092 0.0E+00
sp|Q8Z118|SYV_SALTI Valine--tRNA ligase OS=Salmonella typhi GN=valS PE=3 SV=1 137 1084 0.0E+00
sp|Q6MQK8|SYV_BDEBA Valine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|Q7VN93|SYV_HAEDU Valine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q7MHG1|SYV_VIBVY Valine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=valS PE=3 SV=1 137 1092 0.0E+00
sp|Q8DCE7|SYV_VIBVU Valine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=valS PE=3 SV=1 137 1092 0.0E+00
sp|Q8SS27|SYVC_ENCCU Probable valine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_1140 PE=3 SV=1 85 949 0.0E+00
sp|C1D6J9|SYV_LARHH Valine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=valS PE=3 SV=1 137 1077 0.0E+00
sp|Q83IM5|SYV_SHIFL Valine--tRNA ligase OS=Shigella flexneri GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q5E7U0|SYV_VIBF1 Valine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=valS PE=3 SV=1 137 1091 0.0E+00
sp|Q8ZK31|SYV_SALTY Valine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=valS PE=3 SV=1 137 1084 0.0E+00
sp|Q3YU91|SYV_SHISS Valine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q31TK0|SYV_SHIBS Valine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q8XCB3|SYV_ECO57 Valine--tRNA ligase OS=Escherichia coli O157:H7 GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q6LUW1|SYV_PHOPR Valine--tRNA ligase OS=Photobacterium profundum GN=valS PE=3 SV=2 137 1091 0.0E+00
sp|Q74BJ6|SYV_GEOSL Valine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q8FAD1|SYV_ECOL6 Valine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q0AIF2|SYV_NITEC Valine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=valS PE=3 SV=1 137 1091 0.0E+00
sp|P07118|SYV_ECOLI Valine--tRNA ligase OS=Escherichia coli (strain K12) GN=valS PE=1 SV=2 137 1085 0.0E+00
sp|Q328S3|SYV_SHIDS Valine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q9X2D7|SYV_THEMA Valine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=valS PE=3 SV=1 139 1087 0.0E+00
sp|A8F8Q3|SYV_PSELT Valine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=valS PE=3 SV=1 139 1075 0.0E+00
sp|Q5QY15|SYV_IDILO Valine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=valS PE=3 SV=1 137 1076 0.0E+00
sp|Q54I78|SYVM_DICDI Probable valine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=valS2 PE=3 SV=2 130 979 0.0E+00
sp|Q3II73|SYV_PSEHT Valine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q3Z9C5|SYV_DEHM1 Valine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=valS PE=3 SV=1 137 1073 0.0E+00
sp|A6SUQ8|SYV_JANMA Valine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q8XJ42|SYV_CLOPE Valine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=valS PE=3 SV=1 131 1091 0.0E+00
sp|Q7NUM8|SYV_CHRVO Valine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=valS PE=3 SV=1 137 1088 0.0E+00
sp|Q4FQL0|SYV_PSYA2 Valine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|B7GH39|SYV_ANOFW Valine--tRNA ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=valS PE=3 SV=1 139 1092 0.0E+00
sp|A1K9L8|SYV_AZOSB Valine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=valS PE=3 SV=1 137 1074 0.0E+00
sp|Q7VWK6|SYV_BORPE Valine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=valS PE=3 SV=1 137 1088 0.0E+00
sp|Q8XX80|SYV_RALSO Valine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=valS PE=3 SV=1 133 1075 0.0E+00
sp|Q5KWL3|SYV_GEOKA Valine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=valS PE=3 SV=1 139 1082 0.0E+00
sp|A4G1V2|SYV_HERAR Valine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q7W6P3|SYV_BORPA Valine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=valS PE=3 SV=1 137 1089 0.0E+00
sp|Q7WHM6|SYV_BORBR Valine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=valS PE=3 SV=1 137 1088 0.0E+00
sp|Q3ZZG9|SYV_DEHMC Valine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=valS PE=3 SV=1 137 1073 0.0E+00
sp|P11931|SYV_GEOSE Valine--tRNA ligase OS=Geobacillus stearothermophilus GN=valS PE=1 SV=1 139 1082 0.0E+00
sp|Q5N3J4|SYV_SYNP6 Valine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=valS PE=3 SV=1 139 1081 0.0E+00
sp|Q65GK8|SYV_BACLD Valine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=valS PE=3 SV=1 139 1092 0.0E+00
sp|Q5F5W0|SYV_NEIG1 Valine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=valS PE=3 SV=1 139 1075 0.0E+00
sp|F4KE63|SYVM2_ARATH Valine--tRNA ligase, chloroplastic/mitochondrial 2 OS=Arabidopsis thaliana GN=EMB2247 PE=3 SV=1 137 1075 0.0E+00
sp|Q817R6|SYV_BACCR Valine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=valS PE=3 SV=1 139 1092 0.0E+00
sp|Q9K1H7|SYV_NEIMB Valine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=valS PE=3 SV=1 139 1075 0.0E+00
sp|Q72ZW8|SYV_BACC1 Valine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=valS PE=3 SV=1 139 1092 0.0E+00
sp|Q6HD68|SYV_BACHK Valine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=valS PE=3 SV=1 139 1092 0.0E+00
sp|Q81LD3|SYV_BACAN Valine--tRNA ligase OS=Bacillus anthracis GN=valS PE=3 SV=1 139 1092 0.0E+00
sp|A9BIJ7|SYV_PETMO Valine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=valS PE=3 SV=1 137 1090 0.0E+00
sp|Q633Y6|SYV_BACCZ Valine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=valS PE=3 SV=1 139 1092 0.0E+00
sp|Q9JX22|SYV_NEIMA Valine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=valS PE=3 SV=1 139 1075 0.0E+00
sp|A7HJX5|SYV_FERNB Valine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q5WEQ4|SYV_BACSK Valine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|Q05873|SYV_BACSU Valine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=valS PE=1 SV=3 139 1075 0.0E+00
sp|Q8EPN2|SYV_OCEIH Valine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=valS PE=3 SV=1 139 1075 0.0E+00
sp|Q9K8G8|SYV_BACHD Valine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=valS PE=3 SV=1 139 1090 0.0E+00
sp|Q55522|SYV_SYNY3 Valine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=valS PE=3 SV=1 139 1090 0.0E+00
sp|Q72E47|SYV_DESVH Valine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=valS PE=3 SV=1 137 1089 0.0E+00
sp|Q74JZ8|SYV_LACJO Valine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=valS PE=3 SV=1 139 1092 0.0E+00
sp|Q6GG42|SYV_STAAR Valine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=valS PE=3 SV=1 139 1090 0.0E+00
sp|Q6G2V3|SYV_BARHE Valine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=valS PE=3 SV=1 137 1075 0.0E+00
sp|Q7A0P4|SYV_STAAW Valine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|A8Z2I4|SYV_STAAT Valine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|Q6G8R2|SYV_STAAS Valine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|Q99TJ8|SYV_STAAN Valine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=valS PE=1 SV=1 139 1091 0.0E+00
sp|A6QHJ8|SYV_STAAE Valine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|Q5HFA8|SYV_STAAC Valine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|A5ITI8|SYV_STAA9 Valine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|Q2FXR8|SYV_STAA8 Valine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|Q2FG72|SYV_STAA3 Valine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|A6U2D1|SYV_STAA2 Valine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|Q931Q1|SYV_STAAM Valine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|A7X383|SYV_STAA1 Valine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|B2FMS2|SYV_STRMK Valine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=valS PE=3 SV=1 138 1075 0.0E+00
sp|B4SJ70|SYV_STRM5 Valine--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=valS PE=3 SV=1 138 1075 0.0E+00
sp|B0RVI4|SYV_XANCB Valine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q8PCR7|SYV_XANCP Valine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q4UQP3|SYV_XANC8 Valine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q2YTA0|SYV_STAAB Valine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=valS PE=3 SV=1 139 1091 0.0E+00
sp|Q8CS83|SYV_STAES Valine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=valS PE=3 SV=1 139 1072 0.0E+00
sp|Q5HNN9|SYV_STAEQ Valine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=valS PE=3 SV=1 139 1072 0.0E+00
sp|B9DND4|SYV_STACT Valine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=valS PE=3 SV=1 139 1090 0.0E+00
sp|Q7U3N4|SYV_SYNPX Valine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=valS PE=3 SV=1 137 1060 0.0E+00
sp|Q8PGQ7|SYV_XANAC Valine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=valS PE=3 SV=1 138 1085 0.0E+00
sp|Q46IA7|SYV_PROMT Valine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=valS PE=3 SV=1 137 1081 0.0E+00
sp|Q82ZW6|SYV_ENTFA Valine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q7TUI9|SYV_PROMM Valine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=valS PE=3 SV=2 137 1067 0.0E+00
sp|Q73MZ2|SYV_TREDE Valine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=valS PE=3 SV=1 137 1088 0.0E+00
sp|Q7V9I9|SYV_PROMA Valine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=valS PE=3 SV=1 137 1089 0.0E+00
sp|Q92BG2|SYV_LISIN Valine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q8YX97|SYV_NOSS1 Valine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=valS PE=3 SV=1 139 963 0.0E+00
sp|Q49Y96|SYV_STAS1 Valine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=valS PE=3 SV=1 139 1072 0.0E+00
sp|Q5FKW5|SYV_LACAC Valine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=valS PE=3 SV=1 139 1092 0.0E+00
sp|Q01PF1|SYV_SOLUE Valine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=valS PE=3 SV=1 137 1075 0.0E+00
sp|Q4FM20|SYV_PELUB Valine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=valS PE=3 SV=1 144 1088 0.0E+00
sp|Q8Y6X9|SYV_LISMO Valine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q8G0Y3|SYV_BRUSU Valine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=valS PE=3 SV=1 137 1081 0.0E+00
sp|Q8YGX8|SYV_BRUME Valine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=valS PE=3 SV=1 137 1081 0.0E+00
sp|Q9PH12|SYV_XYLFA Valine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q4L703|SYV_STAHJ Valine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=valS PE=3 SV=1 139 1072 0.0E+00
sp|Q71ZB6|SYV_LISMF Valine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q5H4N5|SYV_XANOR Valine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=valS PE=3 SV=1 138 1085 0.0E+00
sp|B2SPF0|SYV_XANOP Valine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=valS PE=3 SV=1 138 1085 0.0E+00
sp|Q3BP98|SYV_XANC5 Valine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=valS PE=3 SV=1 138 1085 0.0E+00
sp|Q38XD1|SYV_LACSS Valine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=valS PE=3 SV=1 139 1082 0.0E+00
sp|Q6FZB1|SYV_BARQU Valine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=valS PE=3 SV=1 137 1075 0.0E+00
sp|Q87F36|SYV_XYLFT Valine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|B2I6K9|SYV_XYLF2 Valine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q2P7G5|SYV_XANOM Valine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=valS PE=3 SV=1 138 1085 0.0E+00
sp|A6Q3R4|SYV_NITSB Valine--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=valS PE=3 SV=1 139 1089 0.0E+00
sp|Q98LB1|SYV_RHILO Valine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=valS PE=3 SV=1 137 1075 0.0E+00
sp|Q6AMA0|SYV_DESPS Valine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=valS PE=3 SV=1 137 1065 0.0E+00
sp|Q6N6N1|SYV_RHOPA Valine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=valS PE=3 SV=1 137 1057 0.0E+00
sp|C4V924|SYVC_NOSCE Probable valine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_101032 PE=3 SV=1 129 964 0.0E+00
sp|Q88UX7|SYV_LACPL Valine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=valS PE=3 SV=1 139 1075 0.0E+00
sp|Q8DIS8|SYV_THEEB Valine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=valS PE=3 SV=1 139 1065 0.0E+00
sp|B0U1L1|SYV_XYLFM Valine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=valS PE=3 SV=1 137 1085 0.0E+00
sp|Q7NCQ9|SYV_GLOVI Valine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=valS PE=3 SV=1 139 1092 0.0E+00
sp|Q9CDP6|SYV_LACLA Valine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=valS PE=3 SV=1 139 1075 0.0E+00
sp|Q9A8N3|SYV_CAUCR Valine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=valS PE=3 SV=1 137 1060 0.0E+00
sp|A5V592|SYV_SPHWW Valine--tRNA ligase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=valS PE=3 SV=1 137 1083 0.0E+00
sp|P36420|SYV_LACCA Valine--tRNA ligase OS=Lactobacillus casei GN=valS PE=3 SV=2 139 1092 0.0E+00
sp|Q3SSP4|SYV_NITWN Valine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=valS PE=3 SV=1 137 1091 0.0E+00
sp|Q89LR8|SYV_BRADU Valine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=valS PE=3 SV=1 137 1057 0.0E+00
sp|Q5NLA8|SYV_ZYMMO Valine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=valS PE=3 SV=3 137 1079 0.0E+00
sp|P96142|SYV_THETH Valine--tRNA ligase OS=Thermus thermophilus GN=valS PE=1 SV=2 137 1090 0.0E+00
sp|Q5SJ45|SYV_THET8 Valine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=valS PE=3 SV=1 137 1090 0.0E+00
sp|P9WFS9|SYV_MYCTU Valine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=valS PE=1 SV=2 137 1079 0.0E+00
sp|P9WFS8|SYV_MYCTO Valine--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=valS PE=3 SV=2 137 1079 0.0E+00
sp|P67600|SYV_MYCBO Valine--tRNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=valS PE=3 SV=2 137 1079 0.0E+00
sp|Q72JG7|SYV_THET2 Valine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=valS PE=3 SV=1 137 1090 0.0E+00
sp|Q9CBY7|SYV_MYCLE Valine--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=valS PE=3 SV=1 137 1074 0.0E+00
sp|O06851|SYV_STRCO Valine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=valS PE=3 SV=2 139 1079 0.0E+00
sp|Q4JWU8|SYV_CORJK Valine--tRNA ligase OS=Corynebacterium jeikeium (strain K411) GN=valS PE=3 SV=1 138 1079 0.0E+00
sp|Q73XN8|SYV_MYCPA Valine--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=valS PE=3 SV=1 137 1079 0.0E+00
sp|P57447|SYV_BUCAI Valine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q92Q37|SYV_RHIME Valine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=valS PE=3 SV=1 137 1083 0.0E+00
sp|Q8UEN6|SYV_AGRFC Valine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=valS PE=3 SV=1 137 1075 0.0E+00
sp|Q89AG3|SYV_BUCBP Valine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=valS PE=3 SV=1 137 1073 0.0E+00
sp|Q72V30|SYV_LEPIC Valine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=valS PE=3 SV=1 139 1073 0.0E+00
sp|Q8E1B5|SYV_STRA5 Valine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q5M5J8|SYV_STRT2 Valine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=valS PE=3 SV=2 139 1093 0.0E+00
sp|Q8EZT8|SYV_LEPIN Valine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=valS PE=3 SV=2 139 1073 0.0E+00
sp|Q8K9I1|SYV_BUCAP Valine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=valS PE=3 SV=1 137 1093 0.0E+00
sp|Q3K2S4|SYV_STRA1 Valine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q82CA3|SYV_STRAW Valine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=valS PE=3 SV=1 130 1079 0.0E+00
sp|Q48SA4|SYV_STRPM Valine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=valS PE=3 SV=1 139 1088 0.0E+00
sp|O83998|SYV_TREPA Valine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=valS PE=3 SV=1 139 1083 0.0E+00
sp|Q99YS1|SYV_STRP1 Valine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=valS PE=3 SV=1 139 1088 0.0E+00
sp|Q6NFV0|SYV_CORDI Valine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=valS PE=3 SV=1 137 922 0.0E+00
sp|P0DG65|SYV_STRPQ Valine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|P0DG64|SYV_STRP3 Valine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q7M8H7|SYV_WOLSU Valine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=valS PE=3 SV=1 137 1088 0.0E+00
sp|Q5M111|SYV_STRT1 Valine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=valS PE=3 SV=2 139 1093 0.0E+00
sp|Q8KC74|SYV_CHLTE Valine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=valS PE=3 SV=1 137 1076 0.0E+00
sp|Q8P040|SYV_STRP8 Valine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=valS PE=3 SV=1 139 1079 0.0E+00
sp|Q8NN37|SYV_CORGL Valine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=valS PE=3 SV=2 137 1081 0.0E+00
sp|Q8FN65|SYV_COREF Valine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=valS PE=3 SV=2 137 1090 0.0E+00
sp|Q5XAW8|SYV_STRP6 Valine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=valS PE=3 SV=1 139 1079 0.0E+00
sp|Q7UZI3|SYV_PROMP Valine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=valS PE=3 SV=1 132 1081 0.0E+00
sp|Q5Z048|SYV_NOCFA Valine--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=valS PE=3 SV=1 137 1072 0.0E+00
sp|Q8DSL1|SYV_STRMU Valine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q493Z9|SYV_BLOPB Valine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=valS PE=3 SV=1 137 1084 0.0E+00
sp|Q0BTM1|SYV_GRABC Valine--tRNA ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=valS PE=3 SV=1 137 1074 0.0E+00
sp|Q8DQU7|SYV_STRR6 Valine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=valS PE=3 SV=1 139 1075 0.0E+00
sp|Q8E6S0|SYV_STRA3 Valine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q97S45|SYV_STRPN Valine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=valS PE=3 SV=1 139 1093 0.0E+00
sp|Q7VHN2|SYV_HELHP Valine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=valS PE=3 SV=1 137 1079 0.0E+00
sp|Q6MAM1|SYV_PARUW Valine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=valS PE=3 SV=1 137 1087 0.0E+00
sp|A6LIG7|SYV_PARD8 Valine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=valS PE=3 SV=1 139 1087 0.0E+00
sp|O51680|SYV_BORBU Valine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=valS PE=3 SV=1 139 1077 0.0E+00
sp|Q89ZM4|SYV_BACTN Valine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=valS PE=3 SV=1 139 1087 0.0E+00
sp|Q9RY06|SYV_DEIRA Valine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=valS PE=3 SV=1 139 1075 0.0E+00
sp|Q660D6|SYV_BORBP Valine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=valS PE=3 SV=1 139 1077 2.0E-179
sp|Q64XH6|SYV_BACFR Valine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=valS PE=3 SV=1 139 1093 2.0E-179
sp|Q5LGN1|SYV_BACFN Valine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=valS PE=3 SV=1 139 1093 2.0E-179
sp|Q5FN28|SYV_GLUOX Valine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=valS PE=3 SV=1 137 1074 3.0E-179
sp|P56000|SYV_HELPY Valine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=valS PE=3 SV=1 138 996 1.0E-178
sp|Q7X2N3|SYV_SPHEL Valine--tRNA ligase OS=Sphingomonas elodea GN=valS PE=3 SV=1 137 956 9.0E-178
sp|B3ETM6|SYV_AMOA5 Valine--tRNA ligase OS=Amoebophilus asiaticus (strain 5a2) GN=valS PE=3 SV=1 139 1076 9.0E-177
sp|Q9ZK61|SYV_HELPJ Valine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=valS PE=3 SV=1 138 950 2.0E-176
sp|Q1GUM2|SYV_SPHAL Valine--tRNA ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=valS PE=3 SV=1 134 1080 2.0E-176
sp|Q7MVD7|SYV_PORGI Valine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=valS PE=3 SV=1 139 1091 1.0E-174
sp|Q7VQT2|SYV_BLOFL Valine--tRNA ligase OS=Blochmannia floridanus GN=valS PE=3 SV=1 137 1085 1.0E-174
sp|Q5LP30|SYV_RUEPO Valine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=valS PE=3 SV=1 137 1093 4.0E-174
sp|B2RK53|SYV_PORG3 Valine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=valS PE=3 SV=1 139 1091 1.0E-173
sp|Q5HV17|SYV_CAMJR Valine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=valS PE=3 SV=1 144 1075 7.0E-171
sp|Q9PPE4|SYV_CAMJE Valine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=valS PE=3 SV=1 144 1075 3.0E-170
sp|Q6F1B1|SYV_MESFL Valine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=valS PE=3 SV=1 144 1064 8.0E-169
sp|A0M5I5|SYV_GRAFK Valine--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=valS PE=3 SV=1 139 1065 1.0E-168
sp|Q9PK91|SYV_CHLMU Valine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=valS PE=3 SV=1 137 1087 6.0E-166
sp|Q7UXH9|SYV_RHOBA Valine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=valS PE=3 SV=2 174 1091 1.0E-164
sp|A6L3G7|SYV_BACV8 Valine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=valS PE=3 SV=1 139 1087 6.0E-164
sp|Q5L5J6|SYV_CHLAB Valine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=valS PE=3 SV=1 137 1090 1.0E-160
sp|Q6MTU2|SYV_MYCMS Valine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=valS PE=3 SV=1 125 929 1.0E-159
sp|Q9Z987|SYV_CHLPN Valine--tRNA ligase OS=Chlamydia pneumoniae GN=valS PE=3 SV=1 137 1090 4.0E-159
sp|B0B7L8|SYV_CHLT2 Valine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=valS PE=3 SV=1 137 905 2.0E-158
sp|B0BBT3|SYV_CHLTB Valine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=valS PE=3 SV=1 137 905 3.0E-158
sp|Q255D3|SYV_CHLFF Valine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=valS PE=3 SV=1 137 1090 4.0E-158
sp|O14160|SYVM_SCHPO Valine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vas1 PE=3 SV=2 139 1078 7.0E-158
sp|Q8D294|SYV_WIGBR Valine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=valS PE=3 SV=1 139 969 2.0E-157
sp|Q822K4|SYV_CHLCV Valine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=valS PE=3 SV=1 132 911 2.0E-157
sp|O84304|SYV_CHLTR Valine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=valS PE=3 SV=1 137 905 1.0E-155
sp|Q3KM60|SYV_CHLTA Valine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=valS PE=3 SV=1 137 905 1.0E-155
sp|Q9PQM4|SYV_UREPA Valine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=valS PE=3 SV=1 137 1092 2.0E-150
sp|Q4A6B0|SYV_MYCS5 Valine--tRNA ligase OS=Mycoplasma synoviae (strain 53) GN=valS PE=3 SV=1 137 1088 4.0E-144
sp|Q6YRJ6|SYV_ONYPE Valine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=valS PE=3 SV=2 139 1086 1.0E-141
sp|Q5ZZL4|SYV_MYCH2 Valine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=valS PE=3 SV=1 139 1085 8.0E-136
sp|Q4A755|SYV_MYCH7 Valine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=valS PE=3 SV=1 139 1085 2.0E-135
sp|Q4A917|SYV_MYCHJ Valine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=valS PE=3 SV=1 139 959 3.0E-135
sp|P46216|SYV_TRIVA Valine--tRNA ligase (Fragment) OS=Trichomonas vaginalis GN=VALS PE=3 SV=1 219 700 2.0E-130
sp|Q8EX08|SYV_MYCPE Valine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=valS PE=3 SV=2 173 1072 5.0E-130
sp|Q6KID2|SYV_MYCMO Valine--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=valS PE=3 SV=1 137 908 4.0E-128
sp|P47576|SYV_MYCGE Valine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=valS PE=3 SV=1 137 977 3.0E-125
sp|P75304|SYV_MYCPN Valine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=valS PE=3 SV=1 139 927 1.0E-122
sp|Q98QV4|SYV_MYCPU Valine--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=valS PE=3 SV=1 174 903 1.0E-119
sp|Q7NAR7|SYV_MYCGA Valine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=valS PE=3 SV=2 126 1081 5.0E-117
sp|Q3J4Z5|SYV_RHOS4 Valine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=valS PE=3 SV=1 134 572 1.0E-114
sp|A3PHJ6|SYV_RHOS1 Valine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=valS PE=3 SV=1 134 572 2.0E-114
sp|B9KMT9|SYV_RHOSK Valine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=valS PE=3 SV=1 134 572 2.0E-114
sp|O67411|SYV_AQUAE Valine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=valS PE=3 SV=1 137 557 1.0E-92
sp|Q8TVG5|SYV_METKA Valine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=valS PE=3 SV=1 139 905 2.0E-87
sp|Q58413|SYV_METJA Valine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=valS PE=3 SV=1 174 899 1.0E-85
sp|O58052|SYV_PYRHO Valine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=valS PE=3 SV=2 137 962 1.0E-84
sp|O28059|SYV_ARCFU Valine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=valS PE=3 SV=1 137 960 1.0E-84
sp|Q9UY55|SYV_PYRAB Valine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=valS PE=3 SV=1 137 972 3.0E-84
sp|O26861|SYV_METTH Valine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=valS PE=3 SV=2 145 960 7.0E-84
sp|Q8U409|SYV_PYRFU Valine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=valS PE=3 SV=1 137 962 1.0E-83
sp|Q5JGN7|SYV_THEKO Valine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=valS PE=3 SV=1 137 962 1.0E-83
sp|Q9HMG9|SYV_HALSA Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=valS PE=3 SV=1 138 962 2.0E-80
sp|B0R841|SYV_HALS3 Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=valS PE=3 SV=1 138 962 2.0E-80
sp|O67411|SYV_AQUAE Valine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=valS PE=3 SV=1 598 1088 5.0E-77
sp|Q972A3|SYV_SULTO Valine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=valS PE=3 SV=2 137 995 5.0E-77
sp|Q5V1H0|SYV_HALMA Valine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=valS PE=3 SV=1 139 962 1.0E-76
sp|Q3IUE5|SYV_NATPD Valine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=valS PE=3 SV=1 138 906 2.0E-76
sp|Q6LZP0|SYV_METMP Valine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=valS PE=3 SV=1 142 899 3.0E-76
sp|Q8TLI4|SYV_METAC Valine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=valS PE=3 SV=1 137 968 5.0E-74
sp|Q8Q024|SYV_METMA Valine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=valS PE=3 SV=1 137 968 8.0E-74
sp|Q46B32|SYV_METBF Valine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=valS PE=3 SV=1 137 968 2.0E-72
sp|Q4J8X1|SYV_SULAC Valine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=valS PE=3 SV=1 137 967 9.0E-70
sp|Q1RJ74|SYV_RICBR Valine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=valS PE=3 SV=1 137 984 2.0E-69
sp|A0B7C2|SYV_METTP Valine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=valS PE=3 SV=1 137 974 2.0E-69
sp|A8GVS7|SYV_RICB8 Valine--tRNA ligase OS=Rickettsia bellii (strain OSU 85-389) GN=valS PE=3 SV=1 137 984 1.0E-68
sp|C3PLG3|SYV_RICAE Valine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=valS PE=3 SV=1 137 903 3.0E-67
sp|A4J2F4|SYI_DESRM Isoleucine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=ileS PE=3 SV=1 151 940 1.0E-65
sp|Q92GR9|SYV_RICCN Valine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=valS PE=3 SV=1 137 903 2.0E-65
sp|Q9HM29|SYV_THEAC Valine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=valS PE=3 SV=1 144 949 2.0E-65
sp|C4K2L1|SYV_RICPU Valine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=valS PE=3 SV=1 137 903 2.0E-65
sp|Q9YAZ0|SYV_AERPE Valine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=valS PE=3 SV=3 175 905 3.0E-65
sp|Q4UMX8|SYV_RICFE Valine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=valS PE=3 SV=1 137 903 3.0E-65
sp|A8GTB4|SYV_RICRS Valine--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=valS PE=3 SV=1 137 903 1.0E-64
sp|B0BUV1|SYV_RICRO Valine--tRNA ligase OS=Rickettsia rickettsii (strain Iowa) GN=valS PE=3 SV=1 137 903 1.0E-64
sp|Q68W50|SYV_RICTY Valine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=valS PE=3 SV=1 137 962 1.0E-64
sp|B2A2I8|SYI_NATTJ Isoleucine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ileS PE=3 SV=1 150 934 2.0E-64
sp|Q9ZCN6|SYV_RICPR Valine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=valS PE=3 SV=1 137 962 2.0E-64
sp|B9MRZ5|SYI_CALBD Isoleucine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ileS PE=3 SV=1 145 922 7.0E-64
sp|O27428|SYI_METTH Isoleucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ileS PE=3 SV=3 137 1003 7.0E-64
sp|Q97CR9|SYV_THEVO Valine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=valS PE=3 SV=1 144 905 8.0E-64
sp|A8EZQ5|SYV_RICCK Valine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=valS PE=3 SV=1 137 903 9.0E-64
sp|Q97ZK9|SYV_SULSO Valine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=valS PE=3 SV=1 137 979 1.0E-63
sp|Q8R9L3|SYI_CALS4 Isoleucine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=ileS PE=3 SV=1 174 931 2.0E-63
sp|Q8TN62|SYI_METAC Isoleucine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ileS PE=3 SV=1 169 1001 1.0E-62
sp|A5CCE0|SYV_ORITB Valine--tRNA ligase OS=Orientia tsutsugamushi (strain Boryong) GN=valS PE=3 SV=1 139 902 1.0E-62
sp|Q8ZVG2|SYV_PYRAE Valine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=valS PE=3 SV=1 152 903 2.0E-62
sp|O29622|SYI_ARCFU Isoleucine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ileS PE=3 SV=1 139 936 1.0E-61
sp|Q2RK59|SYI_MOOTA Isoleucine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=ileS PE=3 SV=1 166 1019 2.0E-61
sp|Q465G4|SYI_METBF Isoleucine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=ileS PE=3 SV=1 169 949 3.0E-61
sp|Q0AYC7|SYI_SYNWW Isoleucine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=ileS PE=3 SV=1 169 923 4.0E-61
sp|A4XKR2|SYI_CALS8 Isoleucine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=ileS PE=3 SV=1 145 923 7.0E-61
sp|A8F465|SYI_PSELT Isoleucine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ileS PE=3 SV=1 173 941 1.0E-60
sp|P26499|SYI_METTM Isoleucine--tRNA ligase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=ileS PE=1 SV=3 137 991 2.0E-60
sp|A8GPJ3|SYV_RICAH Valine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=valS PE=3 SV=1 162 962 3.0E-60
sp|B0K2W1|SYI_THEPX Isoleucine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=ileS PE=3 SV=1 151 931 6.0E-60
sp|B0K8R7|SYI_THEP3 Isoleucine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=ileS PE=3 SV=1 151 931 6.0E-60
sp|Q5HC99|SYV_EHRRW Valine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=valS PE=3 SV=1 151 905 6.0E-60
sp|P46214|SYI_PYRFU Isoleucine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=ileS PE=3 SV=2 133 1030 2.0E-59
sp|Q8TWY2|SYI_METKA Isoleucine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ileS PE=3 SV=1 167 958 2.0E-59
sp|Q6L1N5|SYV_PICTO Valine--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=valS PE=3 SV=1 144 925 2.0E-59
sp|C5CHA1|SYI_KOSOT Isoleucine--tRNA ligase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ileS PE=3 SV=1 174 1015 4.0E-59
sp|Q3AEP2|SYI_CARHZ Isoleucine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=ileS PE=3 SV=1 174 941 8.0E-59
sp|Q5FF72|SYV_EHRRG Valine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=valS PE=3 SV=1 151 905 8.0E-59
sp|A9BI29|SYI_PETMO Isoleucine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ileS PE=3 SV=1 174 925 1.0E-58
sp|A3PHJ6|SYV_RHOS1 Valine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=valS PE=3 SV=1 613 1093 2.0E-58
sp|B7JJY2|SYI_BACC0 Isoleucine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=ileS PE=3 SV=1 174 933 2.0E-58
sp|Q6HER9|SYI1_BACHK Isoleucine--tRNA ligase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ileS1 PE=3 SV=1 174 933 2.0E-58
sp|O58792|SYI_PYRHO Isoleucine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ileS PE=3 SV=1 133 1030 2.0E-58
sp|C1EPQ9|SYI_BACC3 Isoleucine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=ileS PE=3 SV=1 174 933 2.0E-58
sp|B1I4A3|SYI_DESAP Isoleucine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=ileS PE=3 SV=1 167 942 2.0E-58
sp|Q3J4Z5|SYV_RHOS4 Valine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=valS PE=3 SV=1 613 1093 3.0E-58
sp|B7H6N1|SYI_BACC4 Isoleucine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=ileS PE=3 SV=1 174 933 3.0E-58
sp|Q819R4|SYI1_BACCR Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ileS1 PE=3 SV=1 174 933 3.0E-58
sp|Q8PSV9|SYI_METMA Isoleucine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=ileS PE=3 SV=1 139 949 3.0E-58
sp|C3L730|SYI_BACAC Isoleucine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ileS PE=3 SV=1 174 933 3.0E-58
sp|C3P665|SYI_BACAA Isoleucine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=ileS PE=3 SV=1 174 933 3.0E-58
sp|Q81WE4|SYI1_BACAN Isoleucine--tRNA ligase 1 OS=Bacillus anthracis GN=ileS1 PE=3 SV=1 174 933 3.0E-58
sp|Q732H4|SYI1_BACC1 Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ileS1 PE=3 SV=1 174 923 8.0E-58
sp|Q636D1|SYI1_BACCZ Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ZK / E33L) GN=ileS1 PE=3 SV=1 174 923 9.0E-58
sp|B9KMT9|SYV_RHOSK Valine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=valS PE=3 SV=1 613 1079 1.0E-57
sp|Q3YT16|SYV_EHRCJ Valine--tRNA ligase OS=Ehrlichia canis (strain Jake) GN=valS PE=3 SV=1 167 905 2.0E-57
sp|Q9V072|SYI_PYRAB Isoleucine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ileS PE=3 SV=1 133 1003 2.0E-57
sp|A9VTD5|SYI_BACWK Isoleucine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=ileS PE=3 SV=1 174 923 2.0E-57
sp|B7IUQ5|SYI_BACC2 Isoleucine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=ileS PE=3 SV=1 174 923 2.0E-57
sp|B9K8X3|SYI_THENN Isoleucine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=ileS PE=3 SV=1 174 963 4.0E-57
sp|Q47NK0|SYV_THEFY Valine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=valS PE=3 SV=1 126 981 8.0E-57
sp|Q5P9M8|SYV_ANAMM Valine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=valS PE=3 SV=1 127 858 1.0E-56
sp|A7GRM0|SYI_BACCN Isoleucine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ileS PE=3 SV=1 174 923 1.0E-56
sp|A0B7P3|SYI_METTP Isoleucine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=ileS PE=3 SV=1 139 947 1.0E-56
sp|B9IVX2|SYI_BACCQ Isoleucine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=ileS PE=3 SV=1 174 923 1.0E-56
sp|B7HLM9|SYI_BACC7 Isoleucine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=ileS PE=3 SV=1 174 923 1.0E-56
sp|P46213|SYI_THEMA Isoleucine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ileS PE=3 SV=2 145 993 2.0E-56
sp|A5IML2|SYI_THEP1 Isoleucine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=ileS PE=3 SV=1 145 993 2.0E-56
sp|Q6AK45|SYI_DESPS Isoleucine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=ileS PE=3 SV=1 152 997 6.0E-56
sp|Q5UZ84|SYI_HALMA Isoleucine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ileS PE=3 SV=1 139 931 7.0E-56
sp|A7IAM2|SYI_METB6 Isoleucine--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=ileS PE=3 SV=1 135 940 9.0E-56
sp|Q12ZD1|SYI_METBU Isoleucine--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=ileS PE=3 SV=1 139 949 1.0E-55
sp|Q45477|SYI_BACSU Isoleucine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=ileS PE=3 SV=3 152 938 1.0E-55
sp|Q3A1R3|SYI_PELCD Isoleucine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ileS PE=3 SV=1 150 941 1.0E-55
sp|Q63BZ8|SYI2_BACCZ Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ZK / E33L) GN=ileS2 PE=3 SV=1 171 969 1.0E-55
sp|Q747X9|SYI_GEOSL Isoleucine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ileS PE=3 SV=1 166 930 2.0E-55
sp|Q81E30|SYI2_BACCR Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ileS2 PE=3 SV=2 171 969 2.0E-55
sp|Q5GRK0|SYV_WOLTR Valine--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=valS PE=3 SV=1 144 905 2.0E-55
sp|Q739A1|SYI2_BACC1 Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ileS2 PE=3 SV=1 171 969 2.0E-55
sp|B8CWL4|SYI_HALOH Isoleucine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ileS PE=3 SV=1 150 923 3.0E-55
sp|C0ZG86|SYI_BREBN Isoleucine--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=ileS PE=3 SV=1 152 923 3.0E-55
sp|A2SPV6|SYI_METLZ Isoleucine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=ileS PE=3 SV=1 137 940 4.0E-55
sp|C0QP76|SYI_PERMH Isoleucine--tRNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=ileS PE=3 SV=1 174 982 6.0E-55
sp|A4IM25|SYI_GEOTN Isoleucine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ileS PE=3 SV=1 174 933 8.0E-55
sp|Q5L0V9|SYI_GEOKA Isoleucine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=ileS PE=3 SV=1 174 923 1.0E-54
sp|Q67Q27|SYI_SYMTH Isoleucine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ileS PE=3 SV=1 174 1005 2.0E-54
sp|A3CSI6|SYI_METMJ Isoleucine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ileS PE=3 SV=1 138 988 5.0E-54
sp|Q81R75|SYI2_BACAN Isoleucine--tRNA ligase 2 OS=Bacillus anthracis GN=ileS2 PE=3 SV=1 171 969 6.0E-54
sp|Q65JV7|SYI_BACLD Isoleucine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ileS PE=3 SV=1 174 938 6.0E-54
sp|Q6HJF2|SYI2_BACHK Isoleucine--tRNA ligase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ileS2 PE=3 SV=1 171 969 1.0E-53
sp|A0RDG3|SYI_BACAH Isoleucine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=ileS PE=3 SV=1 171 969 1.0E-53
sp|B8GQR1|SYI_THISH Isoleucine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=ileS PE=3 SV=1 174 1021 2.0E-53
sp|A7HMY6|SYI_FERNB Isoleucine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=ileS PE=3 SV=1 151 925 3.0E-53
sp|Q9XDB4|SYI_FERPD Isoleucine--tRNA ligase OS=Fervidobacterium pennivorans (strain DSM 9078 / Ven5) GN=ileS PE=3 SV=3 150 982 3.0E-53
sp|B7IGT1|SYI_THEAB Isoleucine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=ileS PE=3 SV=1 174 969 6.0E-53
sp|Q7VDV0|SYI_PROMA Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ileS PE=3 SV=1 166 913 7.0E-53
sp|C5D8P2|SYI_GEOSW Isoleucine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=ileS PE=3 SV=1 174 923 1.0E-52
sp|Q7U9G9|SYI_SYNPX Isoleucine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=ileS PE=3 SV=1 166 906 2.0E-52
sp|Q5JJ31|SYI_THEKO Isoleucine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=ileS PE=3 SV=1 133 1030 2.0E-52
sp|Q72JR6|SYI_THET2 Isoleucine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ileS PE=3 SV=2 174 999 4.0E-52
sp|P56690|SYI_THET8 Isoleucine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ileS PE=1 SV=2 174 999 8.0E-52
sp|Q4FPA9|SYI_PELUB Isoleucine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=ileS PE=3 SV=1 150 932 9.0E-52
sp|B8FT35|SYI_DESHD Isoleucine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=ileS PE=3 SV=1 174 910 1.0E-51
sp|Q24TH1|SYI_DESHY Isoleucine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=ileS PE=3 SV=1 174 910 1.0E-51
sp|B7J0S6|SYI_BORBZ Isoleucine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=ileS PE=3 SV=1 174 957 2.0E-51
sp|A6LK77|SYI_THEM4 Isoleucine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=ileS PE=3 SV=1 174 969 2.0E-51
sp|A0KZZ1|SYI_SHESA Isoleucine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=ileS PE=3 SV=1 150 906 2.0E-51
sp|O51773|SYI_BORBU Isoleucine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=ileS PE=3 SV=1 174 957 2.0E-51
sp|B2S1H8|SYI_BORHD Isoleucine--tRNA ligase OS=Borrelia hermsii (strain HS1 / DAH) GN=ileS PE=3 SV=1 174 957 2.0E-51
sp|Q7TUN3|SYI_PROMM Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=ileS PE=3 SV=1 150 906 3.0E-51
sp|Q18GW3|SYI_HALWD Isoleucine--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ileS PE=3 SV=1 139 922 4.0E-51
sp|Q0HFY9|SYI_SHESM Isoleucine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=ileS PE=3 SV=1 150 906 4.0E-51
sp|A6W346|SYI_MARMS Isoleucine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=ileS PE=3 SV=1 173 980 7.0E-51
sp|B2V9T1|SYI_SULSY Isoleucine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=ileS PE=3 SV=1 151 941 7.0E-51
sp|B8CSC1|SYI_SHEPW Isoleucine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ileS PE=3 SV=1 169 911 1.0E-50
sp|Q74NF3|SYV_NANEQ Valine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=valS PE=3 SV=1 139 905 1.0E-50
sp|B5RN32|SYI_BORDL Isoleucine--tRNA ligase OS=Borrelia duttonii (strain Ly) GN=ileS PE=3 SV=1 174 957 1.0E-50
sp|B5RQH0|SYI_BORRA Isoleucine--tRNA ligase OS=Borrelia recurrentis (strain A1) GN=ileS PE=3 SV=1 174 957 2.0E-50
sp|A8FSI2|SYI_SHESH Isoleucine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=ileS PE=3 SV=1 135 941 2.0E-50
sp|Q0HS82|SYI_SHESR Isoleucine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=ileS PE=3 SV=1 150 906 2.0E-50
sp|A1R0Q9|SYI_BORT9 Isoleucine--tRNA ligase OS=Borrelia turicatae (strain 91E135) GN=ileS PE=3 SV=1 174 957 2.0E-50
sp|Q65ZU1|SYI_BORBP Isoleucine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=ileS PE=3 SV=1 174 957 2.0E-50
sp|Q0IDA5|SYI_SYNS3 Isoleucine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=ileS PE=3 SV=1 166 950 2.0E-50
sp|A6WKD4|SYI_SHEB8 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=ileS PE=3 SV=1 150 906 3.0E-50
sp|Q0SM18|SYI_BORAP Isoleucine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=ileS PE=3 SV=1 174 1050 3.0E-50
sp|B7KFT1|SYI_CYAP7 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=ileS PE=3 SV=1 172 908 3.0E-50
sp|B8HMX3|SYI_CYAP4 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ileS PE=3 SV=1 174 906 3.0E-50
sp|Q3J8W1|SYI_NITOC Isoleucine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ileS PE=3 SV=1 166 980 6.0E-50
sp|B0TJA9|SYI_SHEHH Isoleucine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=ileS PE=3 SV=1 169 911 7.0E-50
sp|B8EFC7|SYI_SHEB2 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=ileS PE=3 SV=1 150 906 8.0E-50
sp|B9DPP7|SYI_STACT Isoleucine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=ileS PE=3 SV=1 167 923 9.0E-50
sp|Q9K9V0|SYI_BACHD Isoleucine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ileS PE=3 SV=1 174 1009 9.0E-50
sp|A3D1G5|SYI_SHEB5 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ileS PE=3 SV=1 150 906 1.0E-49
sp|C0R112|SYI_BRAHW Isoleucine--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=ileS PE=3 SV=1 175 941 1.0E-49
sp|O66651|SYI_AQUAE Isoleucine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=ileS PE=3 SV=1 174 941 1.0E-49
sp|A9L4U7|SYI_SHEB9 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=ileS PE=3 SV=1 150 906 2.0E-49
sp|Q3ITY7|SYI_NATPD Isoleucine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ileS PE=3 SV=1 139 949 2.0E-49
sp|A1WY38|SYI_HALHL Isoleucine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=ileS PE=3 SV=1 174 1018 2.0E-49
sp|Q8DGI7|SYI_THEEB Isoleucine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=ileS PE=3 SV=2 174 906 3.0E-49
sp|A8H1H3|SYI_SHEPA Isoleucine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ileS PE=3 SV=1 169 911 3.0E-49
sp|Q846V6|SYI_STAEP Isoleucine--tRNA ligase OS=Staphylococcus epidermidis GN=ileS PE=3 SV=1 167 923 3.0E-49
sp|B7K5H5|SYI_CYAP8 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=ileS PE=3 SV=1 174 937 3.0E-49
sp|Q5HPZ9|SYI_STAEQ Isoleucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ileS PE=3 SV=1 167 923 4.0E-49
sp|A3QBX2|SYI_SHELP Isoleucine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ileS PE=3 SV=1 151 906 4.0E-49
sp|Q8CSX1|SYI_STAES Isoleucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ileS PE=3 SV=1 167 923 5.0E-49
sp|Q8ET99|SYI2_OCEIH Isoleucine--tRNA ligase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ileS2 PE=3 SV=1 173 1048 5.0E-49
sp|B0C872|SYI_ACAM1 Isoleucine--tRNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=ileS PE=3 SV=1 161 906 6.0E-49
sp|A4Y4A4|SYI_SHEPC Isoleucine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ileS PE=3 SV=1 150 906 6.0E-49
sp|A1RMM6|SYI_SHESW Isoleucine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=ileS PE=3 SV=1 150 906 7.0E-49
sp|Q9YF67|SYI_AERPE Isoleucine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=ileS PE=3 SV=1 139 968 7.0E-49
sp|B2IZP5|SYI_NOSP7 Isoleucine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ileS PE=3 SV=1 172 932 1.0E-48
sp|Q8L1B1|SYI2_PSEFL Isoleucine--tRNA ligase 2 OS=Pseudomonas fluorescens GN=ileS2 PE=1 SV=3 143 905 2.0E-48
sp|Q1WTA9|SYI_LACS1 Isoleucine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=ileS PE=3 SV=1 150 905 2.0E-48
sp|B1KIT5|SYI_SHEWM Isoleucine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ileS PE=3 SV=1 174 906 3.0E-48
sp|A8G2P6|SYI_PROM2 Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=ileS PE=3 SV=1 173 906 3.0E-48
sp|Q7V352|SYI_PROMP Isoleucine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ileS PE=3 SV=1 166 932 3.0E-48
sp|Q8EBI4|SYI_SHEON Isoleucine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=ileS PE=3 SV=1 150 906 3.0E-48
sp|Q87S90|SYI_VIBPA Isoleucine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ileS PE=3 SV=1 173 906 5.0E-48
sp|Q03QI3|SYI_LACBA Isoleucine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ileS PE=3 SV=1 162 922 6.0E-48
sp|B5FA60|SYI_VIBFM Isoleucine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=ileS PE=3 SV=1 173 934 7.0E-48
sp|Q8DES7|SYI_VIBVU Isoleucine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=ileS PE=3 SV=1 173 906 7.0E-48
sp|Q7MNM8|SYI_VIBVY Isoleucine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=ileS PE=3 SV=1 173 906 7.0E-48
sp|Q5E7N4|SYI_VIBF1 Isoleucine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ileS PE=3 SV=1 173 934 8.0E-48
sp|Q605M7|SYI_METCA Isoleucine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ileS PE=3 SV=1 174 930 9.0E-48
sp|A9BDK6|SYI_PROM4 Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=ileS PE=3 SV=1 166 913 9.0E-48
sp|B1WVA3|SYI_CYAA5 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=ileS PE=3 SV=1 161 994 1.0E-47
sp|Q8NX29|SYI_STAAW Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=ileS PE=3 SV=1 167 923 1.0E-47
sp|Q6GA19|SYI_STAAS Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=ileS PE=3 SV=1 167 923 1.0E-47
sp|P73505|SYI_SYNY3 Isoleucine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ileS PE=3 SV=1 150 906 1.0E-47
sp|A9NG38|SYI_ACHLI Isoleucine--tRNA ligase OS=Acholeplasma laidlawii (strain PG-8A) GN=ileS PE=3 SV=1 167 1006 1.0E-47
sp|Q03EY9|SYI_PEDPA Isoleucine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=ileS PE=3 SV=1 151 923 2.0E-47
sp|Q2YXH4|SYI_STAAB Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ileS PE=3 SV=1 167 923 2.0E-47
sp|A8Z3N1|SYI_STAAT Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ileS PE=3 SV=1 167 923 2.0E-47
sp|P67509|SYI_STAAN Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=ileS PE=1 SV=1 167 923 2.0E-47
sp|P67508|SYI_STAAM Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ileS PE=3 SV=1 167 923 2.0E-47
sp|A6QG93|SYI_STAAE Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=ileS PE=3 SV=1 167 923 2.0E-47
sp|Q5HGN8|SYI_STAAC Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=ileS PE=3 SV=1 167 923 2.0E-47
sp|A5IS79|SYI_STAA9 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=ileS PE=3 SV=1 167 923 2.0E-47
sp|Q2FZ82|SYI_STAA8 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=ileS PE=3 SV=1 167 923 2.0E-47
sp|Q2FHP4|SYI_STAA3 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=ileS PE=3 SV=1 167 923 2.0E-47
sp|A6U113|SYI_STAA2 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=ileS PE=3 SV=1 167 923 2.0E-47
sp|A7X1D8|SYI_STAA1 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ileS PE=3 SV=1 167 923 2.0E-47
sp|Q49WX5|SYI_STAS1 Isoleucine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ileS PE=3 SV=1 173 923 2.0E-47
sp|Q5N1G1|SYI_SYNP6 Isoleucine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ileS PE=3 SV=1 161 938 3.0E-47
sp|Q4L5P4|SYI_STAHJ Isoleucine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ileS PE=3 SV=1 150 923 3.0E-47
sp|Q8E177|SYI_STRA5 Isoleucine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ileS PE=3 SV=1 145 922 4.0E-47
sp|Q3K2N4|SYI_STRA1 Isoleucine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ileS PE=3 SV=1 145 922 4.0E-47
sp|Q9HN97|SYI_HALSA Isoleucine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=ileS PE=3 SV=1 139 947 4.0E-47
sp|Q1LSS9|SYI_BAUCH Isoleucine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=ileS PE=3 SV=1 173 929 5.0E-47
sp|B2VGR6|SYI_ERWT9 Isoleucine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ileS PE=3 SV=1 173 906 5.0E-47
sp|Q8E6N1|SYI_STRA3 Isoleucine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ileS PE=3 SV=1 145 922 7.0E-47
sp|Q7VP34|SYI_HAEDU Isoleucine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ileS PE=3 SV=1 151 910 8.0E-47
sp|Q6GHP2|SYI_STAAR Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=ileS PE=3 SV=1 167 923 8.0E-47
sp|P41972|SYI1_STAAU Isoleucine--tRNA ligase OS=Staphylococcus aureus GN=ileS PE=1 SV=1 167 923 8.0E-47
sp|Q929Z6|SYI_LISIN Isoleucine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ileS PE=3 SV=1 145 941 8.0E-47
sp|A3PAV8|SYI_PROM0 Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=ileS PE=3 SV=1 174 906 9.0E-47
sp|O67411|SYV_AQUAE Valine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=valS PE=3 SV=1 530 584 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006438 valyl-tRNA aminoacylation Yes
GO:0005524 ATP binding Yes
GO:0002161 aminoacyl-tRNA editing activity Yes
GO:0005737 cytoplasm Yes
GO:0004832 valine-tRNA ligase activity Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0000166 nucleotide binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0019752 carboxylic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0016070 RNA metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008152 metabolic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043167 ion binding No
GO:0044424 intracellular part No
GO:0043168 anion binding No
GO:0006399 tRNA metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0043039 tRNA aminoacylation No
GO:1901360 organic cyclic compound metabolic process No
GO:0016787 hydrolase activity No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0043038 amino acid activation No
GO:0044464 cell part No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0034660 ncRNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6684
MATNSGRGNPIGASEGLAQSTNTPPSIPADTKQELANAAQTGATGVHASGPDAGASPAAADAPKVKSEKELEKER
KKAEKAAKLEAKKARAAQAAAAPVKEKKAKEKKEEEVIPEYVEDTPAGEKKRIRPFDDPNFKAYDPIAVESAWYE
WWEKQGYFKPEFTADGKVKEAGSFVIVHPPPNVTGSLHMGHALGDSLQDVMIRWNRMNGKTTLWLPGCDHAGIST
QSVVENMLWRRQQKTRHDLGRTKFVETVWEWKEDYHKRINKALTRMGGSFDWSREAFTMDANLSAAVAETFVQLH
EEGVIYRANRLVNWCTKLNTALSNLEVSNKELLGRTLLDVPGYDKKVEFGVIVHFKYPVEGSDEALEVATTRVET
MLGDTGIAVHPKDERYKHLVGKNAIHPFIPGRKLPIVADEYVDMEFGTGAVKLTPAHDPNDFNLGQRHNLEFINI
LTDDGLMNENAGPYKGQKRFDVRYTIQDHLKEKGLYVDKKDNPMKVPLCEKSKDIIEPVMKPQWWVRMKELAEPA
MQVVRDGRIVIKPESAEKSYFRWLEDINDWCISRQLWWGHRCPVYFARIEGGSADIPEDKLWFSGRTQEEAERKA
KAALPGKKFTLEQDEDVLDTWFSSGLWPFSTLGWPNKTHDLETLYPTSILETGWDILFFWIARMITLGLKMTGKI
PFKEVYCHSLVRDSEGRKMSKSLGNVIDPLDVISGIKLDDLHQKLHQGNLHPSEVQKAIKYQKTAFPDGIPQCGA
DALRFTMINATTGGGDINLDVKVIHGYRKFCNKIFQATKYVLGSLPPDFKPSRDGAVRGKTLAERWILHKMVSAA
RDINVALAEREFSKSTIIVYRYWYAELCDVYIENSKAIIREGTDEERDSAIQTLYTALEAALTMIHPFMPFITEE
MWQRMPRRPGDETKSIMLARYPQYKAALDDPESEAAYELVLGCTKAARSLMAEYSLKTDADVIIQAYNEVALKNC
TNEVGSIKSLSGKAVRDIKVTGPGAARPAGCVAYPVSTSAAVFLYVKGRVDMDAEIGKAQKRLDKARAVIQRQEK
TLADPGYVGKVAAAVQEADRQKLADATQEAQSFLETIRQFEQLXXXXXXXXXXXXXXFFFFFAQTWLKERPRRL*
Coding >Hirsu2|6684
ATGGCGACCAACAGCGGGCGAGGGAACCCAATCGGGGCGAGCGAGGGCCTCGCGCAGAGCACGAACACGCCGCCT
TCGATCCCAGCCGATACCAAGCAGGAGCTCGCCAACGCTGCTCAGACAGGGGCCACGGGGGTCCACGCCTCTGGT
CCTGATGCCGGCGCTTCCCCGGCAGCCGCCGACGCTCCCAAGGTGAAGTCGGAGAAAGAGTTGGAAAAGGAGCGC
AAGAAAGCCGAGAAGGCCGCCAAACTCGAGGCCAAGAAGGCCAGGGCAGCTCAGGCGGCTGCGGCCCCCGTCAAG
GAGAAGAAGGCCAAGGAGAAGAAGGAGGAGGAAGTGATACCGGAATATGTCGAAGACACGCCCGCCGGCGAGAAG
AAGCGCATCCGCCCCTTCGACGACCCCAATTTCAAGGCCTACGACCCCATCGCCGTCGAGTCGGCCTGGTACGAG
TGGTGGGAGAAGCAGGGCTACTTCAAGCCCGAATTCACCGCCGACGGCAAGGTCAAGGAAGCGGGCAGCTTCGTC
ATCGTCCATCCTCCTCCCAACGTCACGGGCTCTCTGCACATGGGCCATGCCCTGGGCGATTCGCTGCAAGACGTC
ATGATCCGATGGAACAGGATGAACGGCAAGACGACCCTCTGGCTTCCGGGCTGCGACCATGCCGGCATTTCCACC
CAGAGTGTCGTCGAGAACATGCTCTGGAGGCGGCAGCAGAAGACGCGACACGATCTCGGCCGAACCAAGTTCGTC
GAGACCGTCTGGGAATGGAAGGAGGACTATCACAAGCGAATCAACAAGGCGCTGACGCGCATGGGCGGCTCGTTT
GACTGGAGCCGAGAAGCCTTTACCATGGACGCGAACCTGTCCGCAGCCGTGGCCGAGACCTTCGTTCAACTGCAC
GAAGAAGGCGTCATCTACCGAGCGAACAGGCTCGTCAACTGGTGCACAAAACTGAACACGGCCCTCTCCAATCTC
GAGGTGTCAAACAAGGAACTCCTGGGCCGTACGCTCCTCGACGTCCCCGGCTACGACAAGAAGGTTGAGTTTGGT
GTCATCGTTCACTTCAAGTATCCTGTCGAGGGCTCGGACGAGGCTCTAGAGGTGGCAACTACACGTGTTGAGACC
ATGCTCGGCGATACAGGCATTGCGGTTCACCCAAAAGACGAGCGGTACAAGCACCTTGTTGGGAAGAACGCCATT
CACCCCTTCATCCCAGGTCGGAAGCTACCTATCGTGGCCGACGAGTACGTCGACATGGAGTTTGGTACAGGTGCC
GTAAAGCTCACTCCGGCACACGACCCCAACGACTTTAACCTGGGCCAGAGGCATAACCTCGAGTTCATCAACATC
CTGACCGACGACGGTCTGATGAACGAGAATGCCGGGCCGTACAAGGGACAGAAGCGCTTTGACGTCCGGTACACC
ATTCAGGACCATCTCAAGGAAAAGGGCCTATATGTGGACAAGAAGGACAACCCGATGAAGGTTCCGCTCTGCGAA
AAGTCCAAGGACATCATCGAGCCCGTCATGAAACCCCAGTGGTGGGTTCGCATGAAGGAGTTGGCCGAGCCGGCC
ATGCAGGTCGTGCGGGATGGCCGAATCGTGATCAAGCCGGAGTCGGCAGAGAAGAGCTACTTTCGCTGGCTCGAG
GACATCAACGACTGGTGCATCAGCAGACAGCTGTGGTGGGGACACCGATGCCCCGTCTACTTCGCCAGAATCGAG
GGTGGCTCGGCCGACATCCCCGAAGACAAGCTTTGGTTCTCAGGGCGGACGCAGGAAGAGGCAGAGAGGAAAGCC
AAAGCCGCTCTTCCCGGCAAGAAATTCACGCTGGAGCAAGACGAGGATGTCCTCGACACTTGGTTCTCCTCGGGT
CTGTGGCCCTTCAGCACGCTCGGATGGCCCAACAAGACACACGATCTCGAGACGCTCTATCCCACATCCATTCTG
GAGACGGGCTGGGATATTCTCTTCTTCTGGATTGCTCGCATGATCACGCTCGGCCTCAAGATGACTGGCAAGATC
CCCTTCAAGGAGGTCTATTGCCACAGCCTTGTGCGCGACTCCGAGGGCAGGAAGATGAGCAAAAGCTTGGGCAAC
GTCATCGATCCGCTCGACGTCATCTCCGGCATCAAGCTGGACGACTTGCACCAGAAGCTACACCAGGGGAACTTG
CACCCCAGCGAGGTGCAGAAGGCGATCAAGTACCAAAAGACGGCCTTCCCCGACGGCATCCCTCAGTGCGGCGCG
GACGCGCTGCGTTTCACCATGATCAACGCCACCACTGGCGGCGGCGATATCAACCTGGACGTCAAGGTCATTCAC
GGTTACCGGAAGTTCTGCAACAAGATTTTCCAAGCTACCAAGTACGTGCTGGGAAGCCTGCCGCCGGATTTCAAG
CCGTCGCGGGACGGGGCCGTGCGAGGAAAGACTCTCGCAGAGCGCTGGATCCTCCACAAGATGGTCAGCGCCGCA
CGCGACATCAACGTGGCTCTGGCCGAGCGCGAATTCTCCAAGTCGACCATCATCGTCTACCGTTACTGGTACGCC
GAGCTGTGTGACGTCTACATCGAGAACTCCAAGGCCATCATCCGCGAGGGCACCGACGAGGAGCGCGACTCGGCC
ATCCAGACGCTGTACACGGCGCTGGAGGCGGCCCTGACGATGATCCACCCCTTCATGCCCTTCATCACGGAGGAG
ATGTGGCAGAGGATGCCGCGGAGACCAGGCGACGAGACCAAGTCTATCATGCTCGCGAGGTACCCCCAGTACAAG
GCCGCGCTGGACGACCCAGAATCGGAGGCCGCCTATGAACTCGTCCTGGGCTGCACCAAGGCGGCCCGGTCGCTC
ATGGCCGAGTACTCGCTCAAGACGGACGCGGACGTCATCATCCAAGCATACAACGAGGTGGCGCTGAAGAACTGC
ACCAACGAGGTCGGCTCCATCAAGTCGCTCAGCGGCAAGGCGGTGCGGGACATCAAGGTGACGGGGCCGGGCGCG
GCACGGCCGGCCGGCTGCGTGGCCTACCCGGTCTCGACCAGCGCCGCCGTCTTCCTCTACGTCAAGGGCCGGGTC
GACATGGACGCCGAGATCGGCAAGGCGCAGAAGCGGCTGGACAAGGCCCGGGCCGTCATCCAGCGGCAGGAGAAG
ACGCTGGCGGACCCGGGCTACGTCGGCAAGGTGGCGGCGGCGGTGCAGGAGGCGGACCGGCAGAAGCTGGCGGAC
GCGACGCAGGAGGCCCAGAGCTTCCTCGAGACCATCCGGCAGTTTGAGCAGCTGNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNTTTTTTTTTTTTTTTTGCTCAAACATGGCTGAAAGAGCGCCCCCGTCGTCTGTGA
Transcript >Hirsu2|6684
ATGGCGACCAACAGCGGGCGAGGGAACCCAATCGGGGCGAGCGAGGGCCTCGCGCAGAGCACGAACACGCCGCCT
TCGATCCCAGCCGATACCAAGCAGGAGCTCGCCAACGCTGCTCAGACAGGGGCCACGGGGGTCCACGCCTCTGGT
CCTGATGCCGGCGCTTCCCCGGCAGCCGCCGACGCTCCCAAGGTGAAGTCGGAGAAAGAGTTGGAAAAGGAGCGC
AAGAAAGCCGAGAAGGCCGCCAAACTCGAGGCCAAGAAGGCCAGGGCAGCTCAGGCGGCTGCGGCCCCCGTCAAG
GAGAAGAAGGCCAAGGAGAAGAAGGAGGAGGAAGTGATACCGGAATATGTCGAAGACACGCCCGCCGGCGAGAAG
AAGCGCATCCGCCCCTTCGACGACCCCAATTTCAAGGCCTACGACCCCATCGCCGTCGAGTCGGCCTGGTACGAG
TGGTGGGAGAAGCAGGGCTACTTCAAGCCCGAATTCACCGCCGACGGCAAGGTCAAGGAAGCGGGCAGCTTCGTC
ATCGTCCATCCTCCTCCCAACGTCACGGGCTCTCTGCACATGGGCCATGCCCTGGGCGATTCGCTGCAAGACGTC
ATGATCCGATGGAACAGGATGAACGGCAAGACGACCCTCTGGCTTCCGGGCTGCGACCATGCCGGCATTTCCACC
CAGAGTGTCGTCGAGAACATGCTCTGGAGGCGGCAGCAGAAGACGCGACACGATCTCGGCCGAACCAAGTTCGTC
GAGACCGTCTGGGAATGGAAGGAGGACTATCACAAGCGAATCAACAAGGCGCTGACGCGCATGGGCGGCTCGTTT
GACTGGAGCCGAGAAGCCTTTACCATGGACGCGAACCTGTCCGCAGCCGTGGCCGAGACCTTCGTTCAACTGCAC
GAAGAAGGCGTCATCTACCGAGCGAACAGGCTCGTCAACTGGTGCACAAAACTGAACACGGCCCTCTCCAATCTC
GAGGTGTCAAACAAGGAACTCCTGGGCCGTACGCTCCTCGACGTCCCCGGCTACGACAAGAAGGTTGAGTTTGGT
GTCATCGTTCACTTCAAGTATCCTGTCGAGGGCTCGGACGAGGCTCTAGAGGTGGCAACTACACGTGTTGAGACC
ATGCTCGGCGATACAGGCATTGCGGTTCACCCAAAAGACGAGCGGTACAAGCACCTTGTTGGGAAGAACGCCATT
CACCCCTTCATCCCAGGTCGGAAGCTACCTATCGTGGCCGACGAGTACGTCGACATGGAGTTTGGTACAGGTGCC
GTAAAGCTCACTCCGGCACACGACCCCAACGACTTTAACCTGGGCCAGAGGCATAACCTCGAGTTCATCAACATC
CTGACCGACGACGGTCTGATGAACGAGAATGCCGGGCCGTACAAGGGACAGAAGCGCTTTGACGTCCGGTACACC
ATTCAGGACCATCTCAAGGAAAAGGGCCTATATGTGGACAAGAAGGACAACCCGATGAAGGTTCCGCTCTGCGAA
AAGTCCAAGGACATCATCGAGCCCGTCATGAAACCCCAGTGGTGGGTTCGCATGAAGGAGTTGGCCGAGCCGGCC
ATGCAGGTCGTGCGGGATGGCCGAATCGTGATCAAGCCGGAGTCGGCAGAGAAGAGCTACTTTCGCTGGCTCGAG
GACATCAACGACTGGTGCATCAGCAGACAGCTGTGGTGGGGACACCGATGCCCCGTCTACTTCGCCAGAATCGAG
GGTGGCTCGGCCGACATCCCCGAAGACAAGCTTTGGTTCTCAGGGCGGACGCAGGAAGAGGCAGAGAGGAAAGCC
AAAGCCGCTCTTCCCGGCAAGAAATTCACGCTGGAGCAAGACGAGGATGTCCTCGACACTTGGTTCTCCTCGGGT
CTGTGGCCCTTCAGCACGCTCGGATGGCCCAACAAGACACACGATCTCGAGACGCTCTATCCCACATCCATTCTG
GAGACGGGCTGGGATATTCTCTTCTTCTGGATTGCTCGCATGATCACGCTCGGCCTCAAGATGACTGGCAAGATC
CCCTTCAAGGAGGTCTATTGCCACAGCCTTGTGCGCGACTCCGAGGGCAGGAAGATGAGCAAAAGCTTGGGCAAC
GTCATCGATCCGCTCGACGTCATCTCCGGCATCAAGCTGGACGACTTGCACCAGAAGCTACACCAGGGGAACTTG
CACCCCAGCGAGGTGCAGAAGGCGATCAAGTACCAAAAGACGGCCTTCCCCGACGGCATCCCTCAGTGCGGCGCG
GACGCGCTGCGTTTCACCATGATCAACGCCACCACTGGCGGCGGCGATATCAACCTGGACGTCAAGGTCATTCAC
GGTTACCGGAAGTTCTGCAACAAGATTTTCCAAGCTACCAAGTACGTGCTGGGAAGCCTGCCGCCGGATTTCAAG
CCGTCGCGGGACGGGGCCGTGCGAGGAAAGACTCTCGCAGAGCGCTGGATCCTCCACAAGATGGTCAGCGCCGCA
CGCGACATCAACGTGGCTCTGGCCGAGCGCGAATTCTCCAAGTCGACCATCATCGTCTACCGTTACTGGTACGCC
GAGCTGTGTGACGTCTACATCGAGAACTCCAAGGCCATCATCCGCGAGGGCACCGACGAGGAGCGCGACTCGGCC
ATCCAGACGCTGTACACGGCGCTGGAGGCGGCCCTGACGATGATCCACCCCTTCATGCCCTTCATCACGGAGGAG
ATGTGGCAGAGGATGCCGCGGAGACCAGGCGACGAGACCAAGTCTATCATGCTCGCGAGGTACCCCCAGTACAAG
GCCGCGCTGGACGACCCAGAATCGGAGGCCGCCTATGAACTCGTCCTGGGCTGCACCAAGGCGGCCCGGTCGCTC
ATGGCCGAGTACTCGCTCAAGACGGACGCGGACGTCATCATCCAAGCATACAACGAGGTGGCGCTGAAGAACTGC
ACCAACGAGGTCGGCTCCATCAAGTCGCTCAGCGGCAAGGCGGTGCGGGACATCAAGGTGACGGGGCCGGGCGCG
GCACGGCCGGCCGGCTGCGTGGCCTACCCGGTCTCGACCAGCGCCGCCGTCTTCCTCTACGTCAAGGGCCGGGTC
GACATGGACGCCGAGATCGGCAAGGCGCAGAAGCGGCTGGACAAGGCCCGGGCCGTCATCCAGCGGCAGGAGAAG
ACGCTGGCGGACCCGGGCTACGTCGGCAAGGTGGCGGCGGCGGTGCAGGAGGCGGACCGGCAGAAGCTGGCGGAC
GCGACGCAGGAGGCCCAGAGCTTCCTCGAGACCATCCGGCAGTTTGAGCAGCTGNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNTTTTTTTTTTTTTTTTGCTCAAACATGGCTGAAAGAGCGCCCCCGTCGTCTGTGA
Gene >Hirsu2|6684
ATGGCGACCAACAGCGGGCGAGGGAACCCAAGTACGCGTTTTCAAGTGCGCATAGCGATGGAGGCGAACGCTGAC
TCTCGTGCATCGCAGTCGGGGCGAGCGAGGGCCTCGCGCAGAGCACGAACACGCCGCCTTCGATCCCAGCCGATA
CCAAGCAGGAGCTCGCCAACGCTGCTCAGACAGGGGCCACGGGGGTCCACGCCTCTGGTCCTGATGCCGGCGCTT
CCCCGGCAGCCGCCGACGCTCCCAAGGTGAAGTCGGAGAAAGAGTGTGAGTGCTCCTCCATGTTTGTCCGGTTCT
GGCTCTCTGACCGCGAGGCCTGCCGCAGTGGAAAAGGAGCGCAAGAAAGCCGAGAAGGCCGCCAAACTCGAGGCC
AAGAAGGCCAGGGCAGCTCAGGCGGCTGCGGCCCCCGTCAAGGAGAAGAAGGCCAAGGAGAAGAAGGAGGAGGAA
GTGATACCGGAATATGTCGAAGACACGCCCGCCGGCGAGAAGAAGCGCATCCGCCCCTTCGACGACCCCAATTTC
AAGGCCTACGACCCCATCGCCGTCGAGTCGGCCTGGTACGAGTGGTGGGAGAAGCAGGGCTACTTCAAGCCCGAA
TTCACCGCCGACGGCAAGGTCAAGGAAGCGGGCAGCTTCGTCATCGTCCATCCTCCTCCCAACGTCACGGGCTCT
CTGCACATGGGCCATGCCCTGGGCGATTCGCTGCAAGACGTCATGATCCGATGGAACAGGATGAACGGCAAGACG
ACCCTCTGGCTTCCGGGCTGCGACCATGCCGGCATTTCCACCCAGAGTGTCGTCGAGAACATGCTCTGGAGGCGG
CAGCAGAAGACGCGACACGATCTCGGCCGAACCAAGTTCGTCGAGACCGTCTGGGAATGGAAGGAGGACTATCAC
AAGCGAATCAACAAGGCGCTGACGCGCATGGGCGGCTCGTTTGACTGGAGCCGAGAAGGTGAGGGCTTTTTCTCT
TCTCGTGTCATTCAGGGAAGGCTCTCATTCTGACTTTCTTGAAAGCCTTTACCATGGACGCGAACCTGTCCGCAG
CCGTGGCCGAGACCTTCGTTCAACTGCACGAAGAAGGCGTCATCTACCGAGCGAACAGGCTCGTCAACTGGTGCA
CAAAACTGAACACGGCCCTCTCCAATCTCGAGGTGTCAAACAAGGAACTCCTGGGCCGTACGCTCCTCGACGTCC
CCGGCTACGACAAGAAGGTTGAGTTTGGTGTCATCGTTCACTTCAAGTATCCTGTCGAGGGCTCGGACGAGGCTC
TAGAGGTGGCAACTACACGTGTTGAGACCATGCTCGGCGATACAGGCATTGCGGTTCACCCAAAAGACGAGCGGT
ACAAGCACCTTGTTGGGAAGAACGCCATTCACCCCTTCATCCCAGGTCGGAAGCTACCTATCGTGGCCGACGAGT
ACGTCGACATGGAGTTTGGTACAGGTGCCGTAAAGCTCACTCCGGCACACGACCCCAACGACTTTAACCTGGGCC
AGAGGCATAACCTCGAGTTCATCAACATCCTGACCGACGACGGTCTGATGAACGAGAATGCCGGGCCGTACAAGG
GACAGAAGCGCTTTGACGTCCGGTACACCATTCAGGACCATCTCAAGGAAAAGGGCCTATATGTGGACAAGAAGG
ACAACCCGATGAAGGTTCCGCTCTGCGAAAAGTCCAAGGACATCATCGAGCCCGTCATGAAACCCCAGTGGTGGG
TTCGCATGAAGGAGTTGGCCGAGCCGGCCATGCAGGTCGTGCGGGATGGCCGAATCGTGATCAAGCCGGAGTCGG
CAGAGAAGAGCTACTTTCGCTGGCTCGAGGACATCAACGACTGGTGCATCAGCAGACAGCTGTGGTGGGGACACC
GATGCCCCGTCTACTTCGCCAGAATCGAGGGTGGCTCGGCCGACATCCCCGAAGACAAGCTTTGGTTCTCAGGGC
GGACGCAGGAAGAGGCAGAGAGGAAAGCCAAAGCCGCTCTTCCCGGCAAGAAATTCACGCTGGAGCAAGACGAGG
ATGTCCTCGACAGTACGTCCTCTGCTATGCTGTGTAAAGCAAGCATTCTCCGTGCGTGGATGCTGACACCAGAGC
AACAGCTTGGTTCTCCTCGGGTCTGTGGCCCTTCAGCACGCTCGGATGGCCCAACAAGACACACGATCTCGAGAC
GCTCTATCCCACATCCATTCTGGAGACGGGCTGGGATATTCTCTTCTTCTGGATTGCTCGCATGATCACGCTCGG
CCTCAAGATGACTGGCAAGATCCCCTTCAAGGAGGTCTATTGCCACAGCCTTGTGCGCGACTCCGAGGGCAGGAA
GATGAGCAAAAGCTTGGGCAACGTCATCGATCCGCTCGACGTCATCTCCGGCATCAAGCTGGACGACTTGCACCA
GAAGCTACACCAGGGGAACTTGCACCCCAGCGAGGTGCAGAAGGCGATCAAGTACCAAAAGACGGCCTTCCCCGA
CGGCATCCCTCAGTGCGGCGCGGACGCGCTGCGTTTCACCATGATCAACGCCACCACTGGCGGCGGCGATATCAA
CCTGGACGTCAAGGTGTAAGTCGGCATCGCGCCCACGATACATGCAAGCTGCTGATGGTAGTAGCATTCACGGTT
ACCGGAAGTTCTGCAACAAGATTGTAAGTCCATGGTGGATCCCAGGCCATCCCGTCCCCCCTGCCCTAACGCCGC
TGCCCACAGTTCCAAGCTACCAAGTACGTGCTGGGAAGCCTGCCGCCGGATTTCAAGCCGTCGCGGGACGGGGCC
GTGCGAGGAAAGACTCTCGCAGAGCGCTGGATCCTCCACAAGATGGTCAGCGCCGCACGCGACATCAACGTGGCT
CTGGCCGAGCGCGAATTCTCCAAGTCGACCATCATCGTCTACCGTTACTGGTACGCCGAGCTGTGTGACGTCTAC
ATCGAGAACTCCAAGGCCATCATCCGCGAGGGCACCGACGAGGAGCGCGACTCGGCCATCCAGACGCTGTACACG
GCGCTGGAGGCGGCCCTGACGATGATCCACCCCTTCATGCCCTTCATCACGGAGGAGATGTGGCAGAGGATGCCG
CGGAGACCAGGCGACGAGACCAAGTCTATCATGCTCGCGAGGTACCCCCAGTACAAGGCCGCGCTGGACGACCCA
GAATCGGAGGCCGCCTATGAACTCGTCCTGGGCTGCACCAAGGCGGCCCGGTCGCTCATGGCCGAGTACTCGCTC
AAGACGGACGCGGACGGTAAGCGGCGGCGCCCCGGAGGATGAGGTGTGCCCGCGGCTGACAGCTTGTTTCCTCGA
CGCAGTCATCATCCAAGCATACAACGAGGTGGCGCTGAAGAACTGCACCAACGAGGTCGGCTCCATCAAGTCGCT
CAGCGGCAAGGCGGTGCGGGACATCAAGGTGACGGGGCCGGGCGCGGCACGGCCGGCCGGCTGCGTGGCCTACCC
GGTCTCGACCAGCGCCGCCGTCTTCCTCTACGTCAAGGGCCGGGTCGACATGGACGCCGAGATCGGCAAGGCGCA
GAAGCGGCTGGACAAGGCCCGGGCCGTCATCCAGCGGCAGGAGAAGACGCTGGCGGACCCGGGCTACGTCGGCAA
GGTGGCGGCGGCGGTGCAGGAGGCGGACCGGCAGAAGCTGGCGGACGCGACGCAGGAGGCCCAGAGCTTCCTCGA
GACCATCCGGCAGTTTGAGCAGCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTTTTT
TTTTTTTGCTCAAACATGGCTGAAAGAGCGCCCCCGTCGTCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail