Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6680
Gene name
LocationContig_35:45296..46479
Strand-
Gene length (bp)1183
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03452 Anp1 Anp1 2.3E-106 72 335

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53697|MNN9_CANAL Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN9 PE=3 SV=1 72 370 3.0E-116
sp|P39107|MNN9_YEAST Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN9 PE=1 SV=3 3 370 4.0E-115
sp|O36022|MNN9_SCHPO Mannan polymerase complex subunit mnn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnn9 PE=3 SV=1 75 370 3.0E-111
sp|O74745|ANP1_SCHPO Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=anp1 PE=3 SV=1 62 370 3.0E-69
sp|P23642|VAN1_YEAST Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAN1 PE=1 SV=3 72 370 6.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53697|MNN9_CANAL Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN9 PE=3 SV=1 72 370 3.0E-116
sp|P39107|MNN9_YEAST Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN9 PE=1 SV=3 3 370 4.0E-115
sp|O36022|MNN9_SCHPO Mannan polymerase complex subunit mnn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnn9 PE=3 SV=1 75 370 3.0E-111
sp|O74745|ANP1_SCHPO Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=anp1 PE=3 SV=1 62 370 3.0E-69
sp|P23642|VAN1_YEAST Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAN1 PE=1 SV=3 72 370 6.0E-55
sp|P32629|ANP1_YEAST Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANP1 PE=1 SV=3 10 370 5.0E-53
sp|Q00314|VAN1_CANAX Vanadate resistance protein OS=Candida albicans GN=VAN1 PE=3 SV=1 86 370 7.0E-49
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 13 30 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6680
MGSVRLKKANPCTLVLGALLCIFIFVFLIAPSSPKAPRRAPTATAQHHLSPPTLPYKKANSPSGSHTGPPPVTRY
NLNHVTVTGRPIENREHILILTPMARFCPEYWANLLRLSYPHELITLGFILPKTKEGNAATAALQQQIDQTQKRG
PEADRFKSIIILREDFEPAIVSQDEGERHKMSNQKARRAIMAKSRNSLLFTTLGPATSWVLWLDADIVETPPTLI
QDMAKHEKPVLVANCFQRYYDEEKKMMDERPYDYNSWQDSDVATKMAETMGPDDILLEGYAEMATYRTLMAHVGS
PDGDKDLTIPLDGVGGTALLVKADVHRDGAMFPPFAFYHLIETEGFAKMAKRLGWQPYGLPNYRVYHYNE*
Coding >Hirsu2|6680
ATGGGGTCGGTTCGTCTTAAAAAGGCGAACCCGTGCACCCTCGTCCTGGGCGCCCTCCTGTGCATCTTCATCTTC
GTCTTCCTCATCGCGCCCTCGAGCCCCAAGGCTCCGCGGCGGGCCCCGACCGCGACGGCCCAACATCACCTCTCG
CCGCCCACCCTGCCGTACAAGAAGGCGAACTCGCCATCGGGGAGCCATACCGGACCGCCGCCCGTGACGCGCTAC
AACCTCAACCACGTGACGGTCACCGGCCGGCCGATCGAGAACCGGGAGCACATACTGATCCTGACGCCCATGGCG
CGCTTCTGCCCGGAGTACTGGGCCAATCTCCTGCGCCTCAGCTACCCGCACGAGCTCATCACCCTCGGCTTCATC
CTGCCCAAGACGAAGGAAGGCAACGCGGCGACGGCGGCGCTGCAGCAGCAAATCGACCAGACGCAGAAGCGGGGC
CCCGAGGCCGATCGGTTCAAGAGCATCATCATCCTGCGGGAGGACTTCGAGCCGGCCATCGTGTCGCAGGACGAG
GGCGAGCGGCACAAGATGTCGAACCAGAAGGCCCGGCGCGCCATCATGGCCAAGTCGCGCAACTCGCTGCTCTTC
ACCACGCTCGGCCCCGCCACGTCGTGGGTGCTGTGGCTGGACGCCGACATCGTGGAGACGCCGCCGACGCTGATC
CAGGACATGGCCAAGCACGAGAAGCCGGTGCTGGTGGCCAACTGCTTCCAGCGGTACTACGACGAGGAGAAGAAG
ATGATGGACGAGCGCCCGTACGACTACAACAGCTGGCAGGACAGCGACGTGGCGACCAAGATGGCCGAGACGATG
GGGCCCGACGACATCCTGCTCGAGGGCTACGCCGAGATGGCGACGTACCGCACCCTGATGGCCCACGTCGGCAGC
CCAGACGGCGACAAGGACCTGACGATACCGCTCGACGGCGTCGGCGGGACGGCCCTGCTGGTCAAGGCGGACGTG
CACCGCGACGGCGCCATGTTCCCGCCCTTTGCCTTCTACCACCTGATCGAGACGGAGGGCTTCGCCAAGATGGCC
AAGAGGCTGGGCTGGCAGCCGTATGGGCTTCCCAACTACCGGGTGTACCACTACAACGAGTGA
Transcript >Hirsu2|6680
ATGGGGTCGGTTCGTCTTAAAAAGGCGAACCCGTGCACCCTCGTCCTGGGCGCCCTCCTGTGCATCTTCATCTTC
GTCTTCCTCATCGCGCCCTCGAGCCCCAAGGCTCCGCGGCGGGCCCCGACCGCGACGGCCCAACATCACCTCTCG
CCGCCCACCCTGCCGTACAAGAAGGCGAACTCGCCATCGGGGAGCCATACCGGACCGCCGCCCGTGACGCGCTAC
AACCTCAACCACGTGACGGTCACCGGCCGGCCGATCGAGAACCGGGAGCACATACTGATCCTGACGCCCATGGCG
CGCTTCTGCCCGGAGTACTGGGCCAATCTCCTGCGCCTCAGCTACCCGCACGAGCTCATCACCCTCGGCTTCATC
CTGCCCAAGACGAAGGAAGGCAACGCGGCGACGGCGGCGCTGCAGCAGCAAATCGACCAGACGCAGAAGCGGGGC
CCCGAGGCCGATCGGTTCAAGAGCATCATCATCCTGCGGGAGGACTTCGAGCCGGCCATCGTGTCGCAGGACGAG
GGCGAGCGGCACAAGATGTCGAACCAGAAGGCCCGGCGCGCCATCATGGCCAAGTCGCGCAACTCGCTGCTCTTC
ACCACGCTCGGCCCCGCCACGTCGTGGGTGCTGTGGCTGGACGCCGACATCGTGGAGACGCCGCCGACGCTGATC
CAGGACATGGCCAAGCACGAGAAGCCGGTGCTGGTGGCCAACTGCTTCCAGCGGTACTACGACGAGGAGAAGAAG
ATGATGGACGAGCGCCCGTACGACTACAACAGCTGGCAGGACAGCGACGTGGCGACCAAGATGGCCGAGACGATG
GGGCCCGACGACATCCTGCTCGAGGGCTACGCCGAGATGGCGACGTACCGCACCCTGATGGCCCACGTCGGCAGC
CCAGACGGCGACAAGGACCTGACGATACCGCTCGACGGCGTCGGCGGGACGGCCCTGCTGGTCAAGGCGGACGTG
CACCGCGACGGCGCCATGTTCCCGCCCTTTGCCTTCTACCACCTGATCGAGACGGAGGGCTTCGCCAAGATGGCC
AAGAGGCTGGGCTGGCAGCCGTATGGGCTTCCCAACTACCGGGTGTACCACTACAACGAGTGA
Gene >Hirsu2|6680
ATGGGGTCGGTTCGTCTTAAAAAGGCGAACCCGTGCACCCTCGTCCTGGGCGCCCTCCTGTGCATCTTCATCTTC
GTCTTCCTCATCGCGCCCTCGAGCCCCAAGGCTCCGCGGCGGGCCCCGACCGCGACGGCCCAACATCACCTCTCG
CCGCCCACCCTGCCGTACAAGAAGGCGAACTCGCCATCGGGGAGCCATACCGGACCGCCGCCCGTGACGCGCTAC
AACCTCAACCACGTGACGGTCACCGGCCGGCCGATCGAGAACCGGGAGCACATACTGATCCTGACGCCCATGGCG
CGCTTCTGCCCGGAGTACTGGGCCAATCTCCTGCGCCTCAGCTACCCGCACGAGCTCATCACCCTCGGCTTCATC
CTGCCCAAGACGAAGGAAGGCAACGCGGCGACGGCGGCGCTGCAGCAGCAAATCGACCAGACGCAGAAGCGGGGC
CCCGAGGCCGATCGGTTCAAGAGCATCATCATCCTGCGGGAGGACTTCGAGCCGGCCATCGTGTCGCAGGACGAG
GGCGAGCGGCACAAGATGTCGAACCAGAAGGCCCGGCGCGCCATCATGGCCAAGTCGCGCAACTCGCTGCTCTTC
ACCACGCTCGGCCCCGCCACGTCGTGGGTGCTGTGGCTGGACGCCGACATCGTGGAGACGCCGCCGACGCTGATC
CAGGACATGGCCAAGCACGAGAAGCCGGTGCTGGTGGCCAACTGCTTCCAGCGGTACTACGACGAGGAGAAGAAG
ATGATGGACGAGCGCCCGTACGACTACAACAGCTGGCAGGACAGCGACGTGGCGACCAAGATGGCCGAGACGATG
GGGCCCGACGACATCCTGCTCGAGGGCTACGCCGAGATGGCGACGTACCGCACCCTGATGGCCCACGTCGGCAGC
CCAGACGGCGACAAGGACCTGACGATACCGCTCGACGGCGTCGGCGGGACGGCCCTGCTGGTCAAGGCGGACGTG
CACCGCGACGGCGCCATGTTCCCGCCCTTTGCCTTCTACCACCTGATCGAGACGGAGGGCTTCGCCAAGATGGCC
AAGAGGCTGGGCTGGCAGCCGTATGGGCTTCCCAACTACCGGGTAAGCGAACGCGCGCGGGCGAGGCTCCAGGAA
CCCCCCAGGCTGACCAAGATTGTTCGCGACCTGACAGGTGTACCACTACAACGAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail