Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|668
Gene name
LocationContig_1133:3407..4568
Strand-
Gene length (bp)1161
Transcript length (bp)1161
Coding sequence length (bp)1161
Protein length (aa) 387

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11991 Trp_DMAT Tryptophan dimethylallyltransferase 4.5E-100 24 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT20|DMAW1_CLAPU Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea GN=dmaW1 PE=1 SV=1 23 298 3.0E-39
sp|M1WA41|DMAW1_CLAP2 Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea (strain 20.1) GN=dmaW1 PE=3 SV=1 23 298 4.0E-39
sp|Q9C141|DMAW2_CLAP2 Tryptophan dimethylallyltransferase 2 OS=Claviceps purpurea (strain 20.1) GN=dmaW2 PE=3 SV=1 23 298 2.0E-38
sp|Q12594|DMAW_CLAFS Tryptophan dimethylallyltransferase OS=Claviceps fusiformis GN=dmaW PE=1 SV=1 21 376 2.0E-36
sp|Q6X2E3|DMAW_EPINE Tryptophan dimethylallyltransferase OS=Epichloe typhina x Neotyphodium lolii GN=dmaW PE=3 SV=1 24 298 2.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT20|DMAW1_CLAPU Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea GN=dmaW1 PE=1 SV=1 23 298 3.0E-39
sp|M1WA41|DMAW1_CLAP2 Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea (strain 20.1) GN=dmaW1 PE=3 SV=1 23 298 4.0E-39
sp|Q9C141|DMAW2_CLAP2 Tryptophan dimethylallyltransferase 2 OS=Claviceps purpurea (strain 20.1) GN=dmaW2 PE=3 SV=1 23 298 2.0E-38
sp|Q12594|DMAW_CLAFS Tryptophan dimethylallyltransferase OS=Claviceps fusiformis GN=dmaW PE=1 SV=1 21 376 2.0E-36
sp|Q6X2E3|DMAW_EPINE Tryptophan dimethylallyltransferase OS=Epichloe typhina x Neotyphodium lolii GN=dmaW PE=3 SV=1 24 298 2.0E-35
sp|Q6X2E1|DMAW2_EPICN Tryptophan dimethylallyltransferase 2 OS=Epichloe coenophiala GN=dmaW2 PE=3 SV=1 24 298 2.0E-35
sp|Q6X2E2|DMAW1_EPICN Tryptophan dimethylallyltransferase 1 OS=Epichloe coenophiala GN=dmaW1 PE=3 SV=1 24 298 2.0E-34
sp|Q6X1E1|DMAW_BALOB Tryptophan dimethylallyltransferase OS=Balansia obtecta GN=dmaW PE=3 SV=1 21 298 4.0E-33
sp|Q4WYG3|7DMAW_ASPFU 7-dimethylallyltryptophan synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=etpPT PE=1 SV=2 68 375 4.0E-31
sp|Q6Q874|SIRD_LEPMC 4-O-dimethylallyl-L-tyrosine synthase OS=Leptosphaeria maculans GN=sirD PE=1 SV=1 21 375 1.0E-30
sp|Q50EL0|DMAW_ASPFU Tryptophan dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT2 PE=1 SV=2 24 298 2.0E-30
sp|A1DA62|FTMB_NEOFI Tryprostatin B synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT1 PE=3 SV=2 27 378 5.0E-21
sp|Q4WZ67|FGPT1_ASPFU Fumigaclavine A dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT1 PE=1 SV=1 24 376 6.0E-21
sp|Q4WAW7|FTMB_ASPFU Tryprostatin B synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmPT1 PE=1 SV=2 27 378 6.0E-21
sp|B9WZX3|FTMB_ASPFM Tryprostatin B synthase OS=Neosartorya fumigata GN=ftmPT1 PE=3 SV=1 27 378 6.0E-21
sp|I4AY86|BREPT_ASPVE Brevianamide F reverse prenyltransferase OS=Aspergillus versicolor GN=brePT PE=1 SV=1 12 375 1.0E-18
sp|B9WZX7|FTMH_ASPFM 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fumigata GN=ftmPT2 PE=1 SV=1 24 377 7.0E-18
sp|Q4WAX1|FTMH_ASPFU 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmPT2 PE=3 SV=1 24 377 2.0E-17
sp|A1DA66|FTMH_NEOFI 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT2 PE=3 SV=1 19 377 9.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0009820 alkaloid metabolic process Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|668
MIEHSLCGEGAAAAAIEHPKDPKQRWWWDRIAPLLASMLRSSGGYSPEALADHMCVLRDVVIPTLGLPNPEAAAR
PLLTLDGSPFESSWNFTATSDDVIRYTFEPLGNLAGSPEDPFAGDLIPSLVPVLAKAASGADMRWFRQIMEAWVL
LPEEAAVARKKLPPNVSRIPQLFVAFDMKGPRRLLKAYFFPMLKHFAYGTPTETMALDMIRSLEPCGERLAPAAE
KLMKSLERRSHPCPVEMMAIDCIDPTKARVKVYARTQANSLAALREGLTLGGVQTDELTMKGVDAACKIWHLLLD
ERQGLADEAWSKPPREPHTLHKGICFVYELRAGQDRVEVKAHMPYCQSSASDQDSIDNFAEALRTMGWPEAASKY
QNGAKKTESCL*
Coding >Hirsu2|668
ATGATCGAACATTCCCTCTGCGGTGAGGGTGCCGCTGCCGCCGCTATTGAACACCCCAAGGACCCCAAGCAACGC
TGGTGGTGGGATCGCATCGCGCCATTGTTGGCGAGTATGCTCCGTTCGTCTGGCGGCTACAGTCCCGAGGCCCTC
GCCGACCACATGTGCGTCCTTCGCGACGTCGTGATCCCGACACTTGGGCTTCCGAACCCGGAGGCGGCCGCCCGG
CCGCTTCTCACCCTCGATGGCTCTCCTTTTGAGTCGTCGTGGAACTTCACAGCCACTAGCGACGATGTTATACGC
TATACTTTTGAGCCTCTTGGGAACCTCGCCGGCTCTCCGGAGGACCCGTTCGCGGGGGACTTGATCCCGAGCCTG
GTCCCCGTACTCGCCAAGGCCGCCTCCGGCGCCGACATGCGTTGGTTTCGGCAGATCATGGAGGCCTGGGTTCTC
TTACCCGAGGAGGCTGCCGTCGCACGCAAGAAGCTTCCACCAAACGTCTCACGCATCCCCCAACTCTTCGTCGCT
TTTGACATGAAGGGCCCACGGCGCCTACTTAAGGCTTATTTCTTTCCCATGCTCAAGCACTTTGCCTACGGTACG
CCCACCGAGACGATGGCACTCGACATGATCCGCTCGCTCGAGCCGTGCGGCGAGCGTCTGGCCCCAGCCGCCGAG
AAGCTTATGAAGTCGCTGGAAAGGCGCTCCCACCCCTGCCCCGTCGAAATGATGGCCATCGACTGCATCGACCCG
ACCAAGGCGCGAGTTAAGGTCTACGCCCGCACGCAGGCTAACTCACTAGCCGCCCTGCGCGAGGGCCTGACGCTC
GGCGGCGTGCAGACCGACGAGCTGACCATGAAGGGGGTCGATGCCGCCTGCAAGATCTGGCACCTTCTATTGGAC
GAGCGCCAAGGGCTGGCTGACGAGGCGTGGAGCAAGCCGCCGCGAGAGCCGCACACGCTACACAAGGGTATATGC
TTCGTTTACGAGCTGCGTGCCGGCCAGGACCGCGTCGAAGTCAAGGCACACATGCCCTACTGCCAGAGCTCGGCT
AGCGACCAAGACTCCATCGACAACTTTGCCGAGGCGTTGCGCACCATGGGCTGGCCCGAGGCGGCGTCCAAGTAT
CAGAACGGTGCTAAGAAGACCGAGAGTTGCCTGTGA
Transcript >Hirsu2|668
ATGATCGAACATTCCCTCTGCGGTGAGGGTGCCGCTGCCGCCGCTATTGAACACCCCAAGGACCCCAAGCAACGC
TGGTGGTGGGATCGCATCGCGCCATTGTTGGCGAGTATGCTCCGTTCGTCTGGCGGCTACAGTCCCGAGGCCCTC
GCCGACCACATGTGCGTCCTTCGCGACGTCGTGATCCCGACACTTGGGCTTCCGAACCCGGAGGCGGCCGCCCGG
CCGCTTCTCACCCTCGATGGCTCTCCTTTTGAGTCGTCGTGGAACTTCACAGCCACTAGCGACGATGTTATACGC
TATACTTTTGAGCCTCTTGGGAACCTCGCCGGCTCTCCGGAGGACCCGTTCGCGGGGGACTTGATCCCGAGCCTG
GTCCCCGTACTCGCCAAGGCCGCCTCCGGCGCCGACATGCGTTGGTTTCGGCAGATCATGGAGGCCTGGGTTCTC
TTACCCGAGGAGGCTGCCGTCGCACGCAAGAAGCTTCCACCAAACGTCTCACGCATCCCCCAACTCTTCGTCGCT
TTTGACATGAAGGGCCCACGGCGCCTACTTAAGGCTTATTTCTTTCCCATGCTCAAGCACTTTGCCTACGGTACG
CCCACCGAGACGATGGCACTCGACATGATCCGCTCGCTCGAGCCGTGCGGCGAGCGTCTGGCCCCAGCCGCCGAG
AAGCTTATGAAGTCGCTGGAAAGGCGCTCCCACCCCTGCCCCGTCGAAATGATGGCCATCGACTGCATCGACCCG
ACCAAGGCGCGAGTTAAGGTCTACGCCCGCACGCAGGCTAACTCACTAGCCGCCCTGCGCGAGGGCCTGACGCTC
GGCGGCGTGCAGACCGACGAGCTGACCATGAAGGGGGTCGATGCCGCCTGCAAGATCTGGCACCTTCTATTGGAC
GAGCGCCAAGGGCTGGCTGACGAGGCGTGGAGCAAGCCGCCGCGAGAGCCGCACACGCTACACAAGGGTATATGC
TTCGTTTACGAGCTGCGTGCCGGCCAGGACCGCGTCGAAGTCAAGGCACACATGCCCTACTGCCAGAGCTCGGCT
AGCGACCAAGACTCCATCGACAACTTTGCCGAGGCGTTGCGCACCATGGGCTGGCCCGAGGCGGCGTCCAAGTAT
CAGAACGGTGCTAAGAAGACCGAGAGTTGCCTGTGA
Gene >Hirsu2|668
ATGATCGAACATTCCCTCTGCGGTGAGGGTGCCGCTGCCGCCGCTATTGAACACCCCAAGGACCCCAAGCAACGC
TGGTGGTGGGATCGCATCGCGCCATTGTTGGCGAGTATGCTCCGTTCGTCTGGCGGCTACAGTCCCGAGGCCCTC
GCCGACCACATGTGCGTCCTTCGCGACGTCGTGATCCCGACACTTGGGCTTCCGAACCCGGAGGCGGCCGCCCGG
CCGCTTCTCACCCTCGATGGCTCTCCTTTTGAGTCGTCGTGGAACTTCACAGCCACTAGCGACGATGTTATACGC
TATACTTTTGAGCCTCTTGGGAACCTCGCCGGCTCTCCGGAGGACCCGTTCGCGGGGGACTTGATCCCGAGCCTG
GTCCCCGTACTCGCCAAGGCCGCCTCCGGCGCCGACATGCGTTGGTTTCGGCAGATCATGGAGGCCTGGGTTCTC
TTACCCGAGGAGGCTGCCGTCGCACGCAAGAAGCTTCCACCAAACGTCTCACGCATCCCCCAACTCTTCGTCGCT
TTTGACATGAAGGGCCCACGGCGCCTACTTAAGGCTTATTTCTTTCCCATGCTCAAGCACTTTGCCTACGGTACG
CCCACCGAGACGATGGCACTCGACATGATCCGCTCGCTCGAGCCGTGCGGCGAGCGTCTGGCCCCAGCCGCCGAG
AAGCTTATGAAGTCGCTGGAAAGGCGCTCCCACCCCTGCCCCGTCGAAATGATGGCCATCGACTGCATCGACCCG
ACCAAGGCGCGAGTTAAGGTCTACGCCCGCACGCAGGCTAACTCACTAGCCGCCCTGCGCGAGGGCCTGACGCTC
GGCGGCGTGCAGACCGACGAGCTGACCATGAAGGGGGTCGATGCCGCCTGCAAGATCTGGCACCTTCTATTGGAC
GAGCGCCAAGGGCTGGCTGACGAGGCGTGGAGCAAGCCGCCGCGAGAGCCGCACACGCTACACAAGGGTATATGC
TTCGTTTACGAGCTGCGTGCCGGCCAGGACCGCGTCGAAGTCAAGGCACACATGCCCTACTGCCAGAGCTCGGCT
AGCGACCAAGACTCCATCGACAACTTTGCCGAGGCGTTGCGCACCATGGGCTGGCCCGAGGCGGCGTCCAAGTAT
CAGAACGGTGCTAAGAAGACCGAGAGTTGCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail