Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6677
Gene name
LocationContig_35:41515..42046
Strand+
Gene length (bp)531
Transcript length (bp)531
Coding sequence length (bp)531
Protein length (aa) 177

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03208 PRA1 PRA1 family protein 1.4E-36 33 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53633|PRA1_YEAST Prenylated Rab acceptor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP3 PE=1 SV=2 16 176 4.0E-45
sp|Q9UUN5|PRA1_SCHPO PRA1-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC306.02c PE=2 SV=1 34 171 6.0E-35
sp|Q8HY39|PRAF1_CANLF Prenylated Rab acceptor protein 1 OS=Canis lupus familiaris GN=RABAC1 PE=2 SV=1 29 174 1.0E-12
sp|Q9UI14|PRAF1_HUMAN Prenylated Rab acceptor protein 1 OS=Homo sapiens GN=RABAC1 PE=1 SV=1 29 174 2.0E-12
sp|Q52NJ0|PRAF1_PIG Prenylated Rab acceptor protein 1 OS=Sus scrofa GN=RABAC1 PE=2 SV=1 29 174 6.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53633|PRA1_YEAST Prenylated Rab acceptor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP3 PE=1 SV=2 16 176 4.0E-45
sp|Q9UUN5|PRA1_SCHPO PRA1-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC306.02c PE=2 SV=1 34 171 6.0E-35
sp|Q8HY39|PRAF1_CANLF Prenylated Rab acceptor protein 1 OS=Canis lupus familiaris GN=RABAC1 PE=2 SV=1 29 174 1.0E-12
sp|Q9UI14|PRAF1_HUMAN Prenylated Rab acceptor protein 1 OS=Homo sapiens GN=RABAC1 PE=1 SV=1 29 174 2.0E-12
sp|Q52NJ0|PRAF1_PIG Prenylated Rab acceptor protein 1 OS=Sus scrofa GN=RABAC1 PE=2 SV=1 29 174 6.0E-12
sp|Q9Z0S9|PRAF1_MOUSE Prenylated Rab acceptor protein 1 OS=Mus musculus GN=Rabac1 PE=1 SV=1 29 168 2.0E-11
sp|O35394|PRAF1_RAT Prenylated Rab acceptor protein 1 OS=Rattus norvegicus GN=Rabac1 PE=1 SV=1 29 168 2.0E-11
sp|Q1RMH4|PRAF1_BOVIN Prenylated Rab acceptor protein 1 OS=Bos taurus GN=RABAC1 PE=2 SV=1 29 174 3.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 85 107 22
2 128 150 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6677
MSRIQIPLDALTSRFNLQERFQGLRSAPLTGRFSNLRPVSEFLDFKRLSKPANFGEMQSRVNYNLSHFSSNYAVV
FSMLSIYALLTNWLLLFDILLVVAGMFLIGRLEGRDLEIGTFRASSSQLYTGLLIVAVPLGLIASPFSTLLWLIG
ASGVAILGHASFMDKPIDEAFSGEAV*
Coding >Hirsu2|6677
ATGTCGCGCATCCAGATCCCCCTCGACGCCCTGACGTCGCGCTTCAACCTCCAGGAGCGGTTCCAGGGCCTGCGC
TCCGCCCCCCTCACCGGCCGCTTCTCCAACCTGCGCCCCGTCTCCGAGTTCCTCGACTTCAAGCGCCTGTCCAAG
CCGGCCAACTTTGGCGAGATGCAGTCGCGCGTCAACTACAACCTGAGCCACTTCTCCAGCAACTACGCCGTCGTC
TTCAGCATGCTCAGCATCTACGCCCTGCTGACCAACTGGCTGCTGCTCTTCGACATCCTCCTCGTCGTTGCCGGC
ATGTTCCTCATCGGCCGCCTCGAGGGCCGTGACCTCGAAATCGGCACCTTCCGTGCCTCGTCGTCGCAGCTCTAC
ACCGGCCTCCTCATCGTCGCCGTGCCGCTGGGTCTGATCGCCTCGCCCTTCTCCACCCTGCTCTGGCTCATCGGC
GCTTCCGGCGTGGCCATCCTCGGCCACGCCTCCTTCATGGACAAGCCCATCGACGAGGCTTTTTCCGGGGAGGCG
GTCTAG
Transcript >Hirsu2|6677
ATGTCGCGCATCCAGATCCCCCTCGACGCCCTGACGTCGCGCTTCAACCTCCAGGAGCGGTTCCAGGGCCTGCGC
TCCGCCCCCCTCACCGGCCGCTTCTCCAACCTGCGCCCCGTCTCCGAGTTCCTCGACTTCAAGCGCCTGTCCAAG
CCGGCCAACTTTGGCGAGATGCAGTCGCGCGTCAACTACAACCTGAGCCACTTCTCCAGCAACTACGCCGTCGTC
TTCAGCATGCTCAGCATCTACGCCCTGCTGACCAACTGGCTGCTGCTCTTCGACATCCTCCTCGTCGTTGCCGGC
ATGTTCCTCATCGGCCGCCTCGAGGGCCGTGACCTCGAAATCGGCACCTTCCGTGCCTCGTCGTCGCAGCTCTAC
ACCGGCCTCCTCATCGTCGCCGTGCCGCTGGGTCTGATCGCCTCGCCCTTCTCCACCCTGCTCTGGCTCATCGGC
GCTTCCGGCGTGGCCATCCTCGGCCACGCCTCCTTCATGGACAAGCCCATCGACGAGGCTTTTTCCGGGGAGGCG
GTCTAG
Gene >Hirsu2|6677
ATGTCGCGCATCCAGATCCCCCTCGACGCCCTGACGTCGCGCTTCAACCTCCAGGAGCGGTTCCAGGGCCTGCGC
TCCGCCCCCCTCACCGGCCGCTTCTCCAACCTGCGCCCCGTCTCCGAGTTCCTCGACTTCAAGCGCCTGTCCAAG
CCGGCCAACTTTGGCGAGATGCAGTCGCGCGTCAACTACAACCTGAGCCACTTCTCCAGCAACTACGCCGTCGTC
TTCAGCATGCTCAGCATCTACGCCCTGCTGACCAACTGGCTGCTGCTCTTCGACATCCTCCTCGTCGTTGCCGGC
ATGTTCCTCATCGGCCGCCTCGAGGGCCGTGACCTCGAAATCGGCACCTTCCGTGCCTCGTCGTCGCAGCTCTAC
ACCGGCCTCCTCATCGTCGCCGTGCCGCTGGGTCTGATCGCCTCGCCCTTCTCCACCCTGCTCTGGCTCATCGGC
GCTTCCGGCGTGGCCATCCTCGGCCACGCCTCCTTCATGGACAAGCCCATCGACGAGGCTTTTTCCGGGGAGGCG
GTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail