Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6676
Gene name
LocationContig_35:36679..39006
Strand+
Gene length (bp)2327
Transcript length (bp)2229
Coding sequence length (bp)2229
Protein length (aa) 743

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04727 ELMO_CED12 ELMO/CED-12 family 8.9E-46 248 458
PF16457 PH_12 Pleckstrin homology domain 7.7E-37 529 685
PF11841 DUF3361 Domain of unknown function (DUF3361) 6.4E-12 37 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96JJ3|ELMO2_HUMAN Engulfment and cell motility protein 2 OS=Homo sapiens GN=ELMO2 PE=1 SV=2 9 723 5.0E-23
sp|Q5RCC1|ELMO2_PONAB Engulfment and cell motility protein 2 OS=Pongo abelii GN=ELMO2 PE=2 SV=1 9 723 9.0E-23
sp|A4FUD6|ELMO2_BOVIN Engulfment and cell motility protein 2 OS=Bos taurus GN=ELMO2 PE=2 SV=1 9 723 2.0E-22
sp|Q8BPU7|ELMO1_MOUSE Engulfment and cell motility protein 1 OS=Mus musculus GN=Elmo1 PE=1 SV=2 315 723 5.0E-22
sp|Q92556|ELMO1_HUMAN Engulfment and cell motility protein 1 OS=Homo sapiens GN=ELMO1 PE=1 SV=2 315 723 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96JJ3|ELMO2_HUMAN Engulfment and cell motility protein 2 OS=Homo sapiens GN=ELMO2 PE=1 SV=2 9 723 5.0E-23
sp|Q5RCC1|ELMO2_PONAB Engulfment and cell motility protein 2 OS=Pongo abelii GN=ELMO2 PE=2 SV=1 9 723 9.0E-23
sp|A4FUD6|ELMO2_BOVIN Engulfment and cell motility protein 2 OS=Bos taurus GN=ELMO2 PE=2 SV=1 9 723 2.0E-22
sp|Q8BPU7|ELMO1_MOUSE Engulfment and cell motility protein 1 OS=Mus musculus GN=Elmo1 PE=1 SV=2 315 723 5.0E-22
sp|Q92556|ELMO1_HUMAN Engulfment and cell motility protein 1 OS=Homo sapiens GN=ELMO1 PE=1 SV=2 315 723 5.0E-22
sp|Q96BJ8|ELMO3_HUMAN Engulfment and cell motility protein 3 OS=Homo sapiens GN=ELMO3 PE=1 SV=3 9 712 1.0E-21
sp|Q8BHL5|ELMO2_MOUSE Engulfment and cell motility protein 2 OS=Mus musculus GN=Elmo2 PE=1 SV=1 316 723 4.0E-20
sp|Q499U2|ELMO3_RAT Engulfment and cell motility protein 3 OS=Rattus norvegicus GN=Elmo3 PE=2 SV=1 299 712 3.0E-19
sp|Q8BYZ7|ELMO3_MOUSE Engulfment and cell motility protein 3 OS=Mus musculus GN=Elmo3 PE=1 SV=2 299 626 2.0E-18
sp|A6QR40|ELMO3_BOVIN Engulfment and cell motility protein 3 OS=Bos taurus GN=ELMO3 PE=2 SV=1 299 637 4.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6676
MDQSDMPALLSRLASDEDAVRKMAVFKLQTSINDPSFADVFISAGGLVVLRRLLMDAGGNTLAYALQSLARLLEL
DMGWDVFAGPTAADLVERIVELIVTNPLVNILRGAMSILVALVGHSAPDAACASVPPPLSSSPGPFGFRALKPAV
AVYPQFFELVIQQLQSADHALCANALMLINALIRDAVSAAAARRPDDAAAAPGEDWAKLVKRLQDLDLVQTVYRL
MLSSSLHDLALPMLEFQSLSKVLLRCWRDVRVDLDRPEHRRSLKSIHLASAPDRGAHTNGTAAPGGEPQQQQQQQ
QQQQQQQQQQQQAEAGGKKEGRKHNPEKWRRLGFETESPAQEFEATGYLGMMDLTDYVRKHEDAFHKLLLEQAAR
PAAERCPVARASLAVTAILYEHFDIDKADLEDVKGYQGTEAKDQDDLFRPLLLQWPRLHAAGLQSFLRVWKATGA
RQDDLDKVAELVRILVEQVVGRAGRTRGILEVEDEMLEYELGRLREAQMDLLELAFEDSWGRHLHQVREVLRQEA
LQFVKEQRVRCLLQGSWFTRPQQQQRGGPEDEAPGPARPCWRFAKLSHNRRYLHYADFDERMAQDPGLDSLAARV
DLSTTSSVVSNVSVPHEDAKSAASSGGTVPNAAKATTKITIYSYADTAAAAAAAAAAAEQPILTLWPVTQSLASE
WLDGLLMLLNQAPITAETSKLIDLVSGYGLKIRLLNVRMDSAFEGPPPGAGLVPSRDGLDEDYFFEV*
Coding >Hirsu2|6676
ATGGACCAGTCGGACATGCCGGCGCTGCTGTCGCGGCTGGCCAGCGACGAGGACGCGGTGCGCAAGATGGCCGTC
TTCAAGCTGCAGACGTCCATCAACGACCCGTCCTTCGCCGACGTCTTCATCTCGGCCGGCGGCCTCGTCGTCCTG
CGCCGGCTCCTCATGGACGCCGGCGGCAACACGCTCGCCTACGCGCTGCAGAGCCTGGCCCGCCTGCTCGAGCTC
GACATGGGCTGGGACGTCTTCGCCGGCCCGACCGCCGCCGACCTGGTCGAGCGCATCGTCGAGCTCATCGTCACC
AACCCGCTGGTTAACATCCTGAGGGGGGCCATGTCCATCCTCGTCGCCCTCGTCGGCCACTCGGCGCCCGACGCC
GCCTGCGCCTCCGTCCCCCCCCCGCTCTCGTCCTCGCCCGGCCCCTTCGGCTTCCGCGCCCTCAAGCCCGCCGTC
GCCGTCTACCCGCAGTTCTTCGAGCTGGTGATACAGCAGCTGCAGAGCGCCGATCACGCCCTGTGCGCCAACGCC
CTCATGCTCATCAACGCCCTGATCCGCGACGCCGTCTCCGCCGCCGCCGCCCGCCGCCCGGACGACGCCGCCGCC
GCCCCCGGTGAGGACTGGGCCAAGCTCGTCAAGCGCCTGCAGGACCTCGACCTCGTCCAGACCGTCTACCGCCTC
ATGCTCTCCTCGTCCCTGCACGACCTGGCCCTCCCCATGCTCGAGTTCCAGTCGCTGAGCAAGGTCCTGCTCCGC
TGCTGGCGCGACGTGCGCGTCGACCTGGACCGGCCCGAGCACAGGAGGTCCCTCAAGAGCATCCACCTGGCGAGC
GCCCCCGACCGGGGCGCCCACACGAACGGGACGGCCGCGCCCGGGGGCGAGCCGCAACAGCAGCAGCAGCAGCAG
CAGCAGCAGCAACAGCAACAACAACAACAACAGCAGGCCGAGGCTGGCGGCAAAAAGGAAGGCCGCAAGCACAAC
CCCGAGAAGTGGAGGAGACTGGGCTTCGAGACGGAGAGCCCCGCGCAGGAGTTCGAGGCGACCGGCTACCTCGGC
ATGATGGACCTGACCGACTACGTCCGCAAGCACGAGGACGCCTTCCACAAGCTGCTGCTGGAGCAGGCGGCGCGG
CCGGCGGCGGAGCGCTGCCCCGTGGCCCGGGCCAGCCTGGCCGTGACGGCGATCCTGTACGAGCACTTCGACATC
GACAAGGCGGACCTCGAGGACGTCAAGGGATACCAGGGGACCGAGGCCAAGGACCAGGACGACCTGTTCCGGCCG
CTGCTGCTGCAGTGGCCGCGGCTGCACGCGGCCGGCCTGCAGAGCTTCCTGCGCGTCTGGAAGGCGACGGGCGCC
CGGCAGGACGACCTGGACAAGGTGGCCGAGCTGGTGCGCATCCTGGTCGAGCAGGTCGTCGGGCGGGCCGGCCGG
ACGCGGGGCATCCTCGAGGTCGAGGACGAGATGCTCGAGTACGAGCTGGGCCGGCTGCGCGAGGCGCAGATGGAC
CTGCTCGAGCTCGCCTTCGAGGACAGCTGGGGCCGGCACCTGCACCAGGTGCGCGAGGTGCTCCGGCAGGAGGCG
CTGCAGTTCGTCAAGGAGCAGCGGGTGCGCTGCCTGCTGCAGGGCTCGTGGTTCACCAGGCCGCAGCAGCAGCAG
CGAGGCGGACCCGAGGACGAGGCGCCCGGCCCGGCCCGGCCGTGCTGGCGCTTCGCCAAGCTGTCGCACAACCGC
CGCTACCTGCACTACGCCGACTTCGACGAGCGGATGGCGCAGGATCCCGGCCTGGACAGCCTGGCGGCGAGGGTC
GACCTGAGCACGACCAGCTCGGTCGTGTCCAACGTGTCGGTGCCGCACGAGGACGCCAAGAGCGCGGCCAGCAGC
GGCGGCACGGTCCCGAACGCGGCCAAGGCCACGACCAAGATCACCATATACAGCTACGCCGACACGGCGGCGGCG
GCGGCGGCGGCGGCGGCGGCGGCGGAGCAGCCGATCCTGACGCTGTGGCCGGTCACCCAGAGCCTGGCGTCGGAG
TGGCTGGACGGGCTGCTGATGCTGCTCAACCAGGCGCCCATCACGGCGGAGACGAGCAAGCTGATCGACCTGGTC
AGCGGCTACGGCCTGAAGATCCGGCTGCTCAACGTCCGCATGGACTCGGCCTTCGAAGGCCCGCCGCCGGGCGCC
GGCCTCGTGCCCAGCAGGGACGGCCTGGACGAGGACTACTTTTTCGAGGTGTAG
Transcript >Hirsu2|6676
ATGGACCAGTCGGACATGCCGGCGCTGCTGTCGCGGCTGGCCAGCGACGAGGACGCGGTGCGCAAGATGGCCGTC
TTCAAGCTGCAGACGTCCATCAACGACCCGTCCTTCGCCGACGTCTTCATCTCGGCCGGCGGCCTCGTCGTCCTG
CGCCGGCTCCTCATGGACGCCGGCGGCAACACGCTCGCCTACGCGCTGCAGAGCCTGGCCCGCCTGCTCGAGCTC
GACATGGGCTGGGACGTCTTCGCCGGCCCGACCGCCGCCGACCTGGTCGAGCGCATCGTCGAGCTCATCGTCACC
AACCCGCTGGTTAACATCCTGAGGGGGGCCATGTCCATCCTCGTCGCCCTCGTCGGCCACTCGGCGCCCGACGCC
GCCTGCGCCTCCGTCCCCCCCCCGCTCTCGTCCTCGCCCGGCCCCTTCGGCTTCCGCGCCCTCAAGCCCGCCGTC
GCCGTCTACCCGCAGTTCTTCGAGCTGGTGATACAGCAGCTGCAGAGCGCCGATCACGCCCTGTGCGCCAACGCC
CTCATGCTCATCAACGCCCTGATCCGCGACGCCGTCTCCGCCGCCGCCGCCCGCCGCCCGGACGACGCCGCCGCC
GCCCCCGGTGAGGACTGGGCCAAGCTCGTCAAGCGCCTGCAGGACCTCGACCTCGTCCAGACCGTCTACCGCCTC
ATGCTCTCCTCGTCCCTGCACGACCTGGCCCTCCCCATGCTCGAGTTCCAGTCGCTGAGCAAGGTCCTGCTCCGC
TGCTGGCGCGACGTGCGCGTCGACCTGGACCGGCCCGAGCACAGGAGGTCCCTCAAGAGCATCCACCTGGCGAGC
GCCCCCGACCGGGGCGCCCACACGAACGGGACGGCCGCGCCCGGGGGCGAGCCGCAACAGCAGCAGCAGCAGCAG
CAGCAGCAGCAACAGCAACAACAACAACAACAGCAGGCCGAGGCTGGCGGCAAAAAGGAAGGCCGCAAGCACAAC
CCCGAGAAGTGGAGGAGACTGGGCTTCGAGACGGAGAGCCCCGCGCAGGAGTTCGAGGCGACCGGCTACCTCGGC
ATGATGGACCTGACCGACTACGTCCGCAAGCACGAGGACGCCTTCCACAAGCTGCTGCTGGAGCAGGCGGCGCGG
CCGGCGGCGGAGCGCTGCCCCGTGGCCCGGGCCAGCCTGGCCGTGACGGCGATCCTGTACGAGCACTTCGACATC
GACAAGGCGGACCTCGAGGACGTCAAGGGATACCAGGGGACCGAGGCCAAGGACCAGGACGACCTGTTCCGGCCG
CTGCTGCTGCAGTGGCCGCGGCTGCACGCGGCCGGCCTGCAGAGCTTCCTGCGCGTCTGGAAGGCGACGGGCGCC
CGGCAGGACGACCTGGACAAGGTGGCCGAGCTGGTGCGCATCCTGGTCGAGCAGGTCGTCGGGCGGGCCGGCCGG
ACGCGGGGCATCCTCGAGGTCGAGGACGAGATGCTCGAGTACGAGCTGGGCCGGCTGCGCGAGGCGCAGATGGAC
CTGCTCGAGCTCGCCTTCGAGGACAGCTGGGGCCGGCACCTGCACCAGGTGCGCGAGGTGCTCCGGCAGGAGGCG
CTGCAGTTCGTCAAGGAGCAGCGGGTGCGCTGCCTGCTGCAGGGCTCGTGGTTCACCAGGCCGCAGCAGCAGCAG
CGAGGCGGACCCGAGGACGAGGCGCCCGGCCCGGCCCGGCCGTGCTGGCGCTTCGCCAAGCTGTCGCACAACCGC
CGCTACCTGCACTACGCCGACTTCGACGAGCGGATGGCGCAGGATCCCGGCCTGGACAGCCTGGCGGCGAGGGTC
GACCTGAGCACGACCAGCTCGGTCGTGTCCAACGTGTCGGTGCCGCACGAGGACGCCAAGAGCGCGGCCAGCAGC
GGCGGCACGGTCCCGAACGCGGCCAAGGCCACGACCAAGATCACCATATACAGCTACGCCGACACGGCGGCGGCG
GCGGCGGCGGCGGCGGCGGCGGCGGAGCAGCCGATCCTGACGCTGTGGCCGGTCACCCAGAGCCTGGCGTCGGAG
TGGCTGGACGGGCTGCTGATGCTGCTCAACCAGGCGCCCATCACGGCGGAGACGAGCAAGCTGATCGACCTGGTC
AGCGGCTACGGCCTGAAGATCCGGCTGCTCAACGTCCGCATGGACTCGGCCTTCGAAGGCCCGCCGCCGGGCGCC
GGCCTCGTGCCCAGCAGGGACGGCCTGGACGAGGACTACTTTTTCGAGGTGTAG
Gene >Hirsu2|6676
ATGGACCAGTCGGACATGCCGGCGCTGCTGTCGCGGCTGGCCAGCGACGAGGACGCGGTGCGCAAGATGGCCGTC
TTCAAGCTGCAGACGTCCATCAACGACCCGTCCTTCGCCGACGTCTTCATCTCGGCCGGCGGCCTCGTCGTCCTG
CGCCGGCTCCTCATGGACGCCGGCGGCAACACGCTCGCCTACGCGCTGCAGAGCCTGGCCCGCCTGCTCGAGCTC
GACATGGGCTGGGACGTCTTCGCCGGCCCGACCGCCGCCGACCTGGTCGAGCGCATCGTCGAGCTCATCGTCACC
AACCCGCTGGTTAACATCCTGAGGGGGGCCATGTCCATCCTCGTCGCCCTCGTCGGCCACTCGGCGCCCGACGCC
GCCTGCGCCTCCGTCCCCCCCCCGCTCTCGTCCTCGCCCGGCCCCTTCGGCTTCCGCGCCCTCAAGCCCGCCGTC
GCCGTCTACCCGCAGTTCTTCGAGCTGGTGATACAGCAGCTGCAGAGCGCCGATCACGCCCTGTGCGCCAACGCC
CTCATGCTCATCAACGCCCTGATCCGCGACGCCGTCTCCGCCGCCGCCGCCCGCCGCCCGGACGACGCCGCCGCC
GCCCCCGGTGAGGACTGGGCCAAGCTCGTCAAGCGCCTGCAGGACCTCGACCTCGTCCAGACCGTCTACCGCCTC
ATGCTCTCCTCGTCCCTGCACGACCTGGCCCTCCCCATGCTCGAGTTCCAGTCGCTGAGCAAGGTCCTGCTCCGC
TGCTGGCGCGACGTGCGCGTCGACCTGGACCGGCCCGAGCACAGGAGGTCCCTCAAGAGCATCCACCTGGCGAGC
GCCCCCGACCGGGGCGCCCACACGAACGGGACGGCCGCGCCCGGGGGCGAGCCGCAACAGCAGCAGCAGCAGCAG
CAGCAGCAGCAACAGCAACAACAACAACAACAGCAGGCCGAGGCTGGCGGCAAAAAGGAAGGCCGCAAGCACAAC
CCCGAGAAGTGGAGGAGACTGGGCTTCGAGACGGAGAGCCCCGCGCAGGAGTTCGAGGCGACCGGCTACCTCGGC
ATGATGGACCTGACCGACTACGTCCGCAAGCACGAGGACGCCTTCCACAAGCTGCTGCTGGAGCAGGCGGCGCGG
CCGGCGGCGGAGCGCTGCCCCGTGGCCCGGGCCAGCCTGGCCGTGACGGCGATCCTGTACGAGCACTTCGACATC
GACAAGGCGGACCTCGAGGACGTCAAGGGATACCAGGGGACCGAGGCCAAGGACCAGGACGACCTGTTCCGGCCG
CTGCTGCTGCAGTGGCCGCGGCTGCACGCGGCCGGCCTGCAGAGCTTCCTGCGCGTCTGGAAGGCGACGGGCGCC
CGGCAGGACGACCTGGACAAGGTGGCCGAGCTGGTGCGCATCCTGGTCGAGCAGGTCGTCGGGCGGGCCGGCCGG
ACGCGGGGCATCCTCGAGGTCGAGGACGAGATGCTCGAGTACGAGCTGGGCCGGCTGCGCGAGGCGCAGATGGAC
CTGCTCGAGCTCGCCTTCGAGGACAGCTGGGGCCGGCACCTGCACCAGGTGCGCGAGGTGCTCCGGCAGGAGGCG
CTGCAGTTCGTCAAGGAGCAGCGGGTGCGCTGCCTGCTGCAGGGCTCGTGGTTCACCAGGCCGCAGCAGCAGCAG
CGAGGCGGACCCGAGGACGAGGCGCCCGGCCCGGCCCGGCCGTGCTGGCGCTTCGCCAAGCTGTCGCACAACCGC
CGCTACCTGCACTACGCCGACTTCGACGAGCGGATGGCGCAGGATCCCGGCCTGGACAGCCTGGCGGCGAGGGTC
GACCTGAGCACGACCAGCTCGGTCGTGTCCAACGTGTCGGTGCCGCACGAGGACGCCAAGAGCGCGGCCAGCAGC
GGCGGCACGGTCCCGAACGCGGCCAAGGCCACGACCAAGATCACCATATACAGCTACGCCGACACGGCGGCGGTG
GCCGGAGGCGGCGGAGAAGGAGGAGCAGCAGAAGGAGGAGGAGGAGGAGNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNGAGGCGAGGCGGCGGCGGCGGCGGCGGCGGCGGCGGAGCAGCCGATCCTGACGCTGTGGCCGG
TCACCCAGAGCCTGGCGTCGGAGTGGCTGGACGGGCTGCTGATGCTGCTCAACCAGGCGCCCATCACGGCGGAGA
CGAGCAAGCTGATCGACCTGGTCAGCGGCTACGGCCTGAAGATCCGGCTGCTCAACGTCCGCATGGACTCGGCCT
TCGAAGGCCCGCCGCCGGGCGCCGGCCTCGTGCCCAGCAGGGACGGCCTGGACGAGGACTACTTTTTCGAGGTGT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail