Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6673
Gene name
LocationContig_35:26468..30051
Strand+
Gene length (bp)3583
Transcript length (bp)3291
Coding sequence length (bp)3291
Protein length (aa) 1097

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain 1.6E-11 619 670
PF00179 UQ_con Ubiquitin-conjugating enzyme 5.8E-06 977 1056

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VM35|U2QL1_DROME Ubiquitin-conjugating enzyme E2Q-like protein CG4502 OS=Drosophila melanogaster GN=CG4502 PE=2 SV=1 916 1038 2.0E-20
sp|Q8K2Z8|UB2Q2_MOUSE Ubiquitin-conjugating enzyme E2 Q2 OS=Mus musculus GN=Ube2q2 PE=2 SV=2 906 1084 8.0E-20
sp|Q7YQJ9|UB2Q2_RABIT Ubiquitin-conjugating enzyme E2 Q2 OS=Oryctolagus cuniculus GN=UBE2Q2 PE=2 SV=1 906 1084 1.0E-18
sp|Q8WVN8|UB2Q2_HUMAN Ubiquitin-conjugating enzyme E2 Q2 OS=Homo sapiens GN=UBE2Q2 PE=1 SV=1 906 1084 1.0E-18
sp|A0PJN4|U2QL1_MOUSE Ubiquitin-conjugating enzyme E2Q-like protein 1 OS=Mus musculus GN=Ube2ql1 PE=2 SV=2 918 1084 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VM35|U2QL1_DROME Ubiquitin-conjugating enzyme E2Q-like protein CG4502 OS=Drosophila melanogaster GN=CG4502 PE=2 SV=1 916 1038 2.0E-20
sp|Q8K2Z8|UB2Q2_MOUSE Ubiquitin-conjugating enzyme E2 Q2 OS=Mus musculus GN=Ube2q2 PE=2 SV=2 906 1084 8.0E-20
sp|Q7YQJ9|UB2Q2_RABIT Ubiquitin-conjugating enzyme E2 Q2 OS=Oryctolagus cuniculus GN=UBE2Q2 PE=2 SV=1 906 1084 1.0E-18
sp|Q8WVN8|UB2Q2_HUMAN Ubiquitin-conjugating enzyme E2 Q2 OS=Homo sapiens GN=UBE2Q2 PE=1 SV=1 906 1084 1.0E-18
sp|A0PJN4|U2QL1_MOUSE Ubiquitin-conjugating enzyme E2Q-like protein 1 OS=Mus musculus GN=Ube2ql1 PE=2 SV=2 918 1084 2.0E-18
sp|A1L167|U2QL1_HUMAN Ubiquitin-conjugating enzyme E2Q-like protein 1 OS=Homo sapiens GN=UBE2QL1 PE=1 SV=2 918 1084 3.0E-18
sp|Q32L27|UB2Q2_BOVIN Ubiquitin-conjugating enzyme E2 Q2 OS=Bos taurus GN=UBE2Q2 PE=2 SV=1 907 1084 4.0E-17
sp|Q7Z7E8|UB2Q1_HUMAN Ubiquitin-conjugating enzyme E2 Q1 OS=Homo sapiens GN=UBE2Q1 PE=1 SV=1 906 1084 6.0E-17
sp|Q93571|UBC25_CAEEL Ubiquitin-conjugating enzyme E2 25 OS=Caenorhabditis elegans GN=ubc-25 PE=2 SV=2 912 1084 7.0E-17
sp|Q7TSS2|UB2Q1_MOUSE Ubiquitin-conjugating enzyme E2 Q1 OS=Mus musculus GN=Ube2q1 PE=1 SV=2 906 1084 7.0E-17
sp|Q2NL67|PARP6_HUMAN Poly [ADP-ribose] polymerase 6 OS=Homo sapiens GN=PARP6 PE=2 SV=1 548 714 2.0E-14
sp|Q5RDU4|PARP6_PONAB Poly [ADP-ribose] polymerase 6 OS=Pongo abelii GN=PARP6 PE=2 SV=1 548 714 3.0E-14
sp|Q6P6P7|PARP6_MOUSE Poly [ADP-ribose] polymerase 6 OS=Mus musculus GN=Parp6 PE=2 SV=1 548 714 3.0E-14
sp|Q3UD82|PARP8_MOUSE Poly [ADP-ribose] polymerase 8 OS=Mus musculus GN=Parp8 PE=2 SV=1 548 740 3.0E-13
sp|Q8N3A8|PARP8_HUMAN Poly [ADP-ribose] polymerase 8 OS=Homo sapiens GN=PARP8 PE=2 SV=1 548 668 7.0E-13
sp|Q9Y2X8|UB2D4_HUMAN Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens GN=UBE2D4 PE=1 SV=1 915 1048 2.0E-07
sp|D3ZDK2|UB2D1_RAT Ubiquitin-conjugating enzyme E2 D1 OS=Rattus norvegicus GN=Ube2d1 PE=1 SV=1 915 1048 1.0E-06
sp|P61080|UB2D1_MOUSE Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1 915 1048 1.0E-06
sp|P51668|UB2D1_HUMAN Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1 915 1048 1.0E-06
sp|Q2TA10|UB2D1_BOVIN Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus GN=UBE2D1 PE=2 SV=1 915 1048 1.0E-06
sp|A5PKP9|UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis GN=ube2d4 PE=1 SV=1 915 1048 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003950 NAD+ ADP-ribosyltransferase activity Yes
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0016763 transferase activity, transferring pentosyl groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6673
MAFTCSESPDQPNIAEHLESLSSRIPKDSTIGDIISFLSNGLVAKLTDADDGQESQESVDNDVSDDSMFGAAAAQ
EIQPVESSEAATYQPPWKLPLRDEMNLLRRSLQQAQWAGISVGLLPPVRAKMPKLVSLSLPVSRLGLADDALEAW
GLEPDEYLVLLLHLTTGFPAPARYLELYSVEEAFCFRFGKCSSAKPSIASARAAFSDMYNRAGARHAVDEDTSST
DTQNDTSFMLNHMSTSVNRQLNNSLHKLIAIRREQKVSWNAAQEILRSRERGSGFQTPPSGEDCDDGAVISPQAP
AALQHDYALDDEDDLSIPLIAMQLALRQLVRCTEFCTVCHKQLKDDGPGSLKPYVCTDPLCLFQYLSLGFGPSLE
HEVINNPYVVDLLISFFYAAVEQSSLREFPAGLRLKAPMIGDLEQAAIAHLLVGRGELRVVGGMKRSIGQPRDHV
ALAIVYEAATQLFVCRITDVVDAEKHTFKLETVSGPFVQSEDAKEVSQFLEARCAAAEGGWVKALAFSFTHDPEY
LPPEQQKTSLSFILLGIPSSLVLLDWIIASNRSHIVQDQPVVRSSESVDGGLRYAAEYLQFRFAQGSPHKERRFT
QELKEHAVDRLGQAKLFPTLFAWHGSPLKNWHSIIRTGLDFSKRAHGRSYGDGVYMSQNMSVSVQYCGNSVGSVS
KSSKGKSASRPLLPLQWIMSQLVPSQALSICEIVNRPELFVNRTPHYVVNKVEWIQCRYLLVKVDPTYRALAEPF
PGRKTKTCSGFVPQETTLELHGLDHKRFEIPQAAIPAHRRSRIPSPARTRAETQAKPEQGIAEGPESFGRGDRLD
LLTLSAEEVEVEPKGRKGFRDPSPSESSVPKMSGPGASGGEGGAAGGATAGEGPAAGSPLEFRPGSLDHGSLPKL
PAPWWASTSHQALHALSKEVREMHQIQSRSPARELGWCVDTSKIDNLFHWIAELHSFDAALPLARDMARRGCASV
VLEVRFGAGFPLSPPFVRVVRPRFLPFARGGGGHVTAGGAICSELLTGSGWSPALTMEKVLLQVRLGLCDLEPPA
RLDDRAAAADADYGIAEAAAAYTRAAAGHGWQVPADLAQMTHASWA*
Coding >Hirsu2|6673
ATGGCTTTCACTTGCTCCGAGAGCCCAGACCAGCCCAACATCGCTGAACACCTCGAGAGTCTCTCCAGCCGCATT
CCCAAGGACAGTACCATCGGCGACATCATTTCCTTCCTCTCCAACGGACTCGTTGCGAAACTGACCGACGCCGAC
GACGGGCAAGAGTCTCAGGAAAGCGTGGACAACGATGTAAGCGATGATTCTATGTTCGGAGCCGCCGCTGCTCAA
GAGATCCAACCCGTCGAGTCCAGCGAGGCGGCCACATACCAGCCTCCGTGGAAGTTGCCGTTGCGGGACGAGATG
AACCTGCTCAGACGATCTCTACAGCAGGCCCAGTGGGCCGGCATCTCAGTTGGACTTCTTCCGCCTGTGCGTGCA
AAGATGCCCAAACTCGTTTCCCTGTCTCTTCCCGTTTCCCGGCTCGGGCTGGCCGATGATGCTCTGGAAGCGTGG
GGTTTAGAGCCCGACGAGTACTTGGTTCTTCTCCTTCATCTGACCACTGGCTTCCCCGCACCGGCCCGCTATCTC
GAGCTGTACTCTGTCGAAGAGGCCTTTTGTTTTCGATTCGGCAAATGTTCGTCTGCGAAGCCCTCGATCGCCTCG
GCTCGTGCCGCTTTTTCCGACATGTACAACAGAGCCGGAGCGAGACATGCGGTGGACGAGGACACGAGCAGCACG
GATACTCAAAACGACACGAGCTTCATGCTTAATCACATGTCCACCTCGGTGAACCGCCAGCTGAACAACAGCCTC
CACAAACTGATCGCCATCCGCAGAGAACAGAAGGTTTCGTGGAACGCCGCCCAGGAAATTCTGCGAAGCAGGGAA
CGAGGCTCTGGCTTCCAGACGCCCCCCAGTGGCGAAGACTGTGACGACGGAGCGGTCATCAGCCCACAGGCTCCC
GCGGCGCTGCAACATGACTACGCACTCGATGACGAAGACGACCTCAGCATCCCCCTGATTGCCATGCAGCTTGCC
CTACGGCAGCTCGTTCGCTGCACAGAATTCTGTACCGTCTGCCACAAGCAACTGAAGGACGACGGCCCTGGATCC
TTGAAACCCTACGTCTGTACCGACCCTCTCTGCTTGTTCCAGTATCTGTCGCTGGGCTTTGGTCCGAGTCTCGAG
CATGAGGTCATCAACAATCCTTATGTTGTAGATCTTCTCATAAGCTTTTTCTACGCAGCTGTCGAACAGAGCTCG
CTCCGCGAGTTTCCGGCTGGCCTCAGGCTCAAGGCACCGATGATTGGGGATCTCGAACAGGCCGCCATCGCCCAT
CTTCTGGTGGGCAGAGGCGAGCTGCGTGTTGTCGGCGGGATGAAGCGAAGCATCGGCCAACCTCGCGACCATGTT
GCCCTGGCCATTGTTTACGAAGCAGCGACTCAGCTATTTGTCTGCCGCATCACAGACGTCGTGGATGCCGAAAAA
CACACGTTCAAGCTCGAGACCGTGTCGGGCCCCTTTGTACAGTCGGAAGATGCGAAGGAAGTGTCGCAATTTCTG
GAAGCACGCTGCGCGGCGGCCGAGGGTGGCTGGGTCAAAGCTTTAGCTTTTTCGTTCACCCATGACCCCGAGTAT
CTCCCGCCCGAACAGCAGAAGACTTCGCTGAGTTTCATCCTGCTGGGAATCCCATCCTCGCTGGTGCTTCTCGAC
TGGATCATAGCCTCCAATAGATCGCACATCGTCCAGGATCAGCCCGTGGTCCGATCGTCCGAGAGCGTGGATGGC
GGCCTACGGTACGCTGCCGAGTATTTGCAATTCCGATTCGCCCAAGGGTCGCCGCACAAGGAACGCCGTTTCACG
CAAGAGCTGAAGGAGCACGCCGTCGACAGGCTAGGACAGGCGAAGCTCTTCCCGACATTGTTTGCTTGGCACGGA
AGCCCGCTGAAGAACTGGCATAGCATCATCCGAACCGGCCTCGACTTCAGTAAACGGGCGCACGGGCGATCATAC
GGGGACGGGGTGTACATGAGCCAAAACATGTCCGTAAGTGTCCAGTACTGCGGTAACAGCGTGGGCAGCGTGAGC
AAAAGCTCCAAGGGAAAATCTGCTTCGCGACCTTTGCTGCCGTTGCAGTGGATCATGTCCCAACTTGTGCCCTCT
CAGGCTCTCAGCATATGCGAAATCGTCAACAGGCCCGAGTTGTTCGTGAACAGGACGCCGCACTACGTCGTCAAC
AAGGTCGAGTGGATCCAGTGTCGGTATCTACTTGTCAAGGTAGATCCCACATACAGAGCGCTCGCGGAGCCGTTT
CCAGGACGCAAGACGAAGACGTGCAGCGGCTTTGTGCCCCAAGAAACCACACTCGAGCTCCACGGACTGGACCAC
AAGCGCTTCGAGATTCCGCAGGCGGCCATTCCGGCCCATCGGCGCAGTCGCATCCCTTCCCCAGCCCGTACGCGA
GCAGAGACGCAAGCTAAGCCCGAGCAGGGAATTGCCGAAGGCCCCGAGTCCTTCGGGCGCGGGGACAGGCTCGAT
CTTCTGACCCTCTCTGCCGAAGAGGTAGAAGTCGAGCCCAAGGGACGCAAAGGATTTCGAGATCCGTCGCCCAGC
GAGTCGTCGGTTCCGAAGATGTCCGGTCCAGGCGCGAGCGGTGGCGAAGGAGGGGCCGCGGGAGGGGCCACGGCA
GGCGAGGGCCCGGCGGCCGGTTCGCCGCTCGAGTTCCGCCCCGGCAGCCTGGACCACGGCTCGCTGCCGAAGCTG
CCGGCGCCGTGGTGGGCGAGCACGTCGCACCAGGCGCTCCACGCGCTCAGCAAGGAGGTGCGCGAGATGCACCAG
ATCCAGAGCCGGAGCCCGGCGCGGGAGCTGGGCTGGTGCGTGGACACGAGCAAGATCGACAACCTGTTCCACTGG
ATCGCCGAGCTGCACAGCTTCGACGCGGCGCTGCCGCTGGCGCGCGACATGGCGCGGCGCGGCTGCGCCAGCGTC
GTGCTCGAGGTGCGCTTCGGCGCCGGCTTCCCCCTGTCGCCGCCGTTCGTGCGCGTCGTGCGGCCGCGCTTCCTG
CCCTTCGCCCGCGGCGGCGGCGGCCACGTCACGGCCGGCGGCGCCATCTGCTCCGAGCTGCTCACCGGCTCCGGC
TGGTCGCCGGCCCTGACGATGGAGAAGGTGCTGCTGCAAGTGCGCCTCGGCCTCTGCGACCTCGAGCCGCCCGCC
CGGCTCGACGACCGCGCCGCCGCCGCCGACGCCGACTACGGCATAGCCGAGGCGGCGGCCGCCTATACGCGCGCC
GCCGCCGGCCACGGCTGGCAGGTCCCGGCCGACTTGGCGCAGATGACCCACGCGAGCTGGGCCTGA
Transcript >Hirsu2|6673
ATGGCTTTCACTTGCTCCGAGAGCCCAGACCAGCCCAACATCGCTGAACACCTCGAGAGTCTCTCCAGCCGCATT
CCCAAGGACAGTACCATCGGCGACATCATTTCCTTCCTCTCCAACGGACTCGTTGCGAAACTGACCGACGCCGAC
GACGGGCAAGAGTCTCAGGAAAGCGTGGACAACGATGTAAGCGATGATTCTATGTTCGGAGCCGCCGCTGCTCAA
GAGATCCAACCCGTCGAGTCCAGCGAGGCGGCCACATACCAGCCTCCGTGGAAGTTGCCGTTGCGGGACGAGATG
AACCTGCTCAGACGATCTCTACAGCAGGCCCAGTGGGCCGGCATCTCAGTTGGACTTCTTCCGCCTGTGCGTGCA
AAGATGCCCAAACTCGTTTCCCTGTCTCTTCCCGTTTCCCGGCTCGGGCTGGCCGATGATGCTCTGGAAGCGTGG
GGTTTAGAGCCCGACGAGTACTTGGTTCTTCTCCTTCATCTGACCACTGGCTTCCCCGCACCGGCCCGCTATCTC
GAGCTGTACTCTGTCGAAGAGGCCTTTTGTTTTCGATTCGGCAAATGTTCGTCTGCGAAGCCCTCGATCGCCTCG
GCTCGTGCCGCTTTTTCCGACATGTACAACAGAGCCGGAGCGAGACATGCGGTGGACGAGGACACGAGCAGCACG
GATACTCAAAACGACACGAGCTTCATGCTTAATCACATGTCCACCTCGGTGAACCGCCAGCTGAACAACAGCCTC
CACAAACTGATCGCCATCCGCAGAGAACAGAAGGTTTCGTGGAACGCCGCCCAGGAAATTCTGCGAAGCAGGGAA
CGAGGCTCTGGCTTCCAGACGCCCCCCAGTGGCGAAGACTGTGACGACGGAGCGGTCATCAGCCCACAGGCTCCC
GCGGCGCTGCAACATGACTACGCACTCGATGACGAAGACGACCTCAGCATCCCCCTGATTGCCATGCAGCTTGCC
CTACGGCAGCTCGTTCGCTGCACAGAATTCTGTACCGTCTGCCACAAGCAACTGAAGGACGACGGCCCTGGATCC
TTGAAACCCTACGTCTGTACCGACCCTCTCTGCTTGTTCCAGTATCTGTCGCTGGGCTTTGGTCCGAGTCTCGAG
CATGAGGTCATCAACAATCCTTATGTTGTAGATCTTCTCATAAGCTTTTTCTACGCAGCTGTCGAACAGAGCTCG
CTCCGCGAGTTTCCGGCTGGCCTCAGGCTCAAGGCACCGATGATTGGGGATCTCGAACAGGCCGCCATCGCCCAT
CTTCTGGTGGGCAGAGGCGAGCTGCGTGTTGTCGGCGGGATGAAGCGAAGCATCGGCCAACCTCGCGACCATGTT
GCCCTGGCCATTGTTTACGAAGCAGCGACTCAGCTATTTGTCTGCCGCATCACAGACGTCGTGGATGCCGAAAAA
CACACGTTCAAGCTCGAGACCGTGTCGGGCCCCTTTGTACAGTCGGAAGATGCGAAGGAAGTGTCGCAATTTCTG
GAAGCACGCTGCGCGGCGGCCGAGGGTGGCTGGGTCAAAGCTTTAGCTTTTTCGTTCACCCATGACCCCGAGTAT
CTCCCGCCCGAACAGCAGAAGACTTCGCTGAGTTTCATCCTGCTGGGAATCCCATCCTCGCTGGTGCTTCTCGAC
TGGATCATAGCCTCCAATAGATCGCACATCGTCCAGGATCAGCCCGTGGTCCGATCGTCCGAGAGCGTGGATGGC
GGCCTACGGTACGCTGCCGAGTATTTGCAATTCCGATTCGCCCAAGGGTCGCCGCACAAGGAACGCCGTTTCACG
CAAGAGCTGAAGGAGCACGCCGTCGACAGGCTAGGACAGGCGAAGCTCTTCCCGACATTGTTTGCTTGGCACGGA
AGCCCGCTGAAGAACTGGCATAGCATCATCCGAACCGGCCTCGACTTCAGTAAACGGGCGCACGGGCGATCATAC
GGGGACGGGGTGTACATGAGCCAAAACATGTCCGTAAGTGTCCAGTACTGCGGTAACAGCGTGGGCAGCGTGAGC
AAAAGCTCCAAGGGAAAATCTGCTTCGCGACCTTTGCTGCCGTTGCAGTGGATCATGTCCCAACTTGTGCCCTCT
CAGGCTCTCAGCATATGCGAAATCGTCAACAGGCCCGAGTTGTTCGTGAACAGGACGCCGCACTACGTCGTCAAC
AAGGTCGAGTGGATCCAGTGTCGGTATCTACTTGTCAAGGTAGATCCCACATACAGAGCGCTCGCGGAGCCGTTT
CCAGGACGCAAGACGAAGACGTGCAGCGGCTTTGTGCCCCAAGAAACCACACTCGAGCTCCACGGACTGGACCAC
AAGCGCTTCGAGATTCCGCAGGCGGCCATTCCGGCCCATCGGCGCAGTCGCATCCCTTCCCCAGCCCGTACGCGA
GCAGAGACGCAAGCTAAGCCCGAGCAGGGAATTGCCGAAGGCCCCGAGTCCTTCGGGCGCGGGGACAGGCTCGAT
CTTCTGACCCTCTCTGCCGAAGAGGTAGAAGTCGAGCCCAAGGGACGCAAAGGATTTCGAGATCCGTCGCCCAGC
GAGTCGTCGGTTCCGAAGATGTCCGGTCCAGGCGCGAGCGGTGGCGAAGGAGGGGCCGCGGGAGGGGCCACGGCA
GGCGAGGGCCCGGCGGCCGGTTCGCCGCTCGAGTTCCGCCCCGGCAGCCTGGACCACGGCTCGCTGCCGAAGCTG
CCGGCGCCGTGGTGGGCGAGCACGTCGCACCAGGCGCTCCACGCGCTCAGCAAGGAGGTGCGCGAGATGCACCAG
ATCCAGAGCCGGAGCCCGGCGCGGGAGCTGGGCTGGTGCGTGGACACGAGCAAGATCGACAACCTGTTCCACTGG
ATCGCCGAGCTGCACAGCTTCGACGCGGCGCTGCCGCTGGCGCGCGACATGGCGCGGCGCGGCTGCGCCAGCGTC
GTGCTCGAGGTGCGCTTCGGCGCCGGCTTCCCCCTGTCGCCGCCGTTCGTGCGCGTCGTGCGGCCGCGCTTCCTG
CCCTTCGCCCGCGGCGGCGGCGGCCACGTCACGGCCGGCGGCGCCATCTGCTCCGAGCTGCTCACCGGCTCCGGC
TGGTCGCCGGCCCTGACGATGGAGAAGGTGCTGCTGCAAGTGCGCCTCGGCCTCTGCGACCTCGAGCCGCCCGCC
CGGCTCGACGACCGCGCCGCCGCCGCCGACGCCGACTACGGCATAGCCGAGGCGGCGGCCGCCTATACGCGCGCC
GCCGCCGGCCACGGCTGGCAGGTCCCGGCCGACTTGGCGCAGATGACCCACGCGAGCTGGGCCTGA
Gene >Hirsu2|6673
ATGGCTTTCACTTGCTCCGAGAGCCCAGACCAGCCCAACATCGCTGAACACCTCGAGAGTCTCTCCAGCCGCATT
CCCAAGGACAGTACCATCGGCGACATCATTTCCTTCCTCTCCAACGGACTCGTTGCGAAACTGACCGACGCCGAC
GACGGGCAAGAGTCTCAGGAAAGCGTGGACAACGATGTAAGCGATGATTCTATGTTCGGAGCCGCCGCTGCTCAA
GAGATCCAACCCGTCGAGTCCAGCGAGGCGGCCACATACCAGCCTCCGTGGAAGTTGCCGTTGCGGGACGAGATG
AACCTGCTCAGACGATCTCTACAGCAGGCCCAGTGGGCCGGCATCTCAGTTGGACTTCTTCCGCCTGTGCGTGCA
AAGATGCCCAAACTCGTTTCCCTGTCTCTTCCCGTTTCCCGGCTCGGGCTGGCCGATGATGCTCTGGAAGCGTGG
GGTTTAGAGCCCGACGAGTACTTGGTTCTTCTCCTTCATCTGACCACTGGCTTCCCCGCACCGGCCCGCTATCTC
GAGCTGTACTCTGTCGAAGAGGCCTTTTGTTTTCGATTCGGCAAATGTTCGTCTGCGAAGCCCTCGATCGCCTCG
GCTCGTGCCGCTTTTTCCGACATGTACAACAGAGCCGGAGCGAGACATGCGGTGGACGAGGACACGAGCAGCACG
GATACTCAAAACGACACGAGCTTCATGCTTAATCACATGTCCACCTCGGTGAACCGCCAGCTGAACAACAGCCTC
CACAAACTGATCGCCATCCGCAGAGAACAGAAGGTTTCGTGGAACGCCGCCCAGGAAATTCTGCGAAGCAGGGAA
CGAGGCTCTGGCTTCCAGACGCCCCCCAGTGGCGAAGACTGTGACGACGGAGCGGTCATCAGCCCACAGGCTCCC
GCGGCGCTGCAACATGACTACGCACTCGATGACGAAGACGACCTCAGCATCCCCCTGATTGCCATGCAGCTTGCC
CTACGGCAGCTCGTTCGCTGCACAGAATTCTGTACCGTCTGCCACAAGCAACTGAAGGACGACGGCCCTGGATCC
TTGAAACCCTACGTCTGTACCGACCCTCTCTGCTTGTTCCAGTATCTGTCGCTGGGCTTTGGTCCGAGTCTCGAG
CATGAGGTCATCAACAATCCTTATGTTGTAGATCTTCTCATAAGCTTTTTCTACGCAGCTGTCGAACAGAGCTCG
CTCCGCGAGTTTCCGGCTGGCCTCAGGCTCAAGGCACCGATGATTGGGGATCTCGAACAGGCCGCCATCGCCCAT
CTTCTGGTGGGCAGAGGCGAGCTGCGTGTTGTCGGCGGGATGAAGCGAAGCATCGGCCAACCTCGCGACCATGTT
GCCCTGGCCATTGTTTACGAAGCAGGTGAGTCATATCCCTTTTGTGCCTTCTGCTCATCACGGCGGTCTGCGATT
GCTGCTCGCGTTCCCTCGAAGCCGTTATATCAGTGCAAGCGCTGCTGCGGAGTTCATTCATATCTTATAAGCCCC
CACCCATGATGCTGTTGCTGATGATGCCTTAGCGACTCAGCTATTTGTCTGCCGCATCACAGACGTCGTGGATGC
CGAAAAACACACGTTCAAGCTCGAGACCGTGTCGGGCCCCTTTGTACAGTCGGAAGATGCGAAGGAAGTGTCGCA
ATTTCTGGAAGCACGCTGCGCGGCGGCCGAGGGTGGCTGGGTCAAAGCTTTAGCTTTTTCGTTCACCCATGACCC
CGAGTATCTCCCGCCCGAACAGCAGAAGACTTCGCTGAGTTTCATCCTGCTGGGAATCCCGTCCGTATTGGATAT
GAGAGCTTACTTGACACGCAACCCGGGAGGGCGACTGTCTTGCTGGAACAGGATGAGCAGATCCTCGCTGGTGCT
TCTCGACTGGATCATAGCCTCCAATAGATCGCACATCGTCCAGGATCAGCCCGTGGTCCGATCGTCCGAGAGCGT
GGATGGCGGCCTACGGTACGCTGCCGAGTATTTGCAATTCCGATTCGCCCAAGGGTCGCCGCACAAGGAACGCCG
TTTCACGCAAGAGCTGAAGGAGCACGCCGTCGACAGGCTAGGACAGGCGAAGCTCTTCCCGACATTGTTTGCTTG
GCACGGAAGCCCGCTGAAGAACTGGCATAGCATCATCCGAACCGGCCTCGACTTCAGTAAACGGGCGCACGGGCG
ATCATACGGGGACGGGGTGTACATGAGCCAAAACATGTCCGTAAGTGTCCAGTACTGCGGTAACAGCGTGGGCAG
CGTGAGCAAAAGCTCCAAGGGAAAATCTGCTTCGCGACCTTTGCTGGTGAGTTTGGTCCGGCGGCAAGCTTCTTC
GTGGCTGGTTTACTAACCTTGCCTCCCACAGCCGTTGCAGTGGATCATGTCCCAACTTGTGCCCTCTCAGGCTCT
CAGCATATGCGAAATCGTCAACAGGCCCGAGTTGTTCGTGAACAGGACGCCGCACTACGTCGTCAACAAGGTCGA
GTGGATCCAGTGTCGGTATCTACTTGTCAAGGTAGATCCCACATACAGAGCGCTCGCGGAGCCGTTTCCAGGACG
CAAGACGAAGACGTGCAGCGGCTTTGTGCCCCAAGAAACCACACTCGAGCTCCACGGACTGGACCACAAGCGCTT
CGAGATTCCGCAGGCGGCCATTCCGGCCCATCGGCGCAGTCGCATCCCTTCCCCAGCCCGTACGCGAGCAGAGAC
GCAAGCTAAGCCCGAGCAGGGAATTGCCGAAGGCCCCGAGTCCTTCGGGCGCGGGGACAGGCTCGATCTTCTGAC
CCTCTCTGCCGAAGAGGTAGAAGTCGAGCCCAAGGGACGCAAAGGATTTCGAGATCCGTCGCCCAGCGAGTCGTC
GGTTCCGAAGATGTCCGGTCCAGGCGCGAGCGGTGGCGAAGGAGGGGCCGCGGGAGGGGCCACGGCAGGCGAGGG
CCCGGCGGCCGGTTCGCCGCTCGAGTTCCGCCCCGGCAGCCTGGACCACGGCTCGCTGCCGAAGCTGCCGGCGCC
GTGGTGGGCGAGCACGTCGCACCAGGCGCTCCACGCGCTCAGCAAGGAGGTGCGCGAGATGCACCAGATCCAGAG
CCGGAGCCCGGCGCGGGAGCTGGGCTGGTGCGTGGACACGAGCAAGATCGACAACCTGTTCCACTGGATCGCCGA
GCTGCACAGCTTCGACGCGGCGCTGCCGCTGGCGCGCGACATGGCGCGGCGCGGCTGCGCCAGCGTCGTGCTCGA
GGTGCGCTTCGGCGCCGGCTTCCCCCTGTCGCCGCCGTTCGTGCGCGTCGTGCGGCCGCGCTTCCTGCCCTTCGC
CCGCGGCGGCGGCGGCCACGTCACGGCCGGCGGCGCCATCTGCTCCGAGCTGCTCACCGGCTCCGGCTGGTCGCC
GGCCCTGACGATGGAGAAGGTGCTGCTGCAAGTGCGCCTCGGCCTCTGCGACCTCGAGCCGCCCGCCCGGCTCGA
CGACCGCGCCGCCGCCGCCGACGCCGACTACGGCATAGCCGAGGCGGCGGCCGCCTATACGCGCGCCGCCGCCGG
CCACGGCTGGCAGGTCCCGGCCGACTTGGCGCAGATGACCCACGCGAGCTGGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail