Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|667
Gene name
LocationContig_1133:606..1989
Strand-
Gene length (bp)1383
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 5.1E-47 60 409

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 7 405 8.0E-55
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 33 409 1.0E-38
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 33 409 5.0E-37
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 24 409 4.0E-35
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 25 409 4.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 7 405 8.0E-55
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 33 409 1.0E-38
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 33 409 5.0E-37
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 24 409 4.0E-35
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 25 409 4.0E-35
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 25 409 4.0E-35
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 25 409 4.0E-35
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 33 409 4.0E-34
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 24 409 8.0E-33
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 62 409 1.0E-30
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 14 409 4.0E-30
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 13 409 1.0E-29
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 125 409 1.0E-19
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 69 409 6.0E-19
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 105 409 1.0E-18
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 119 409 2.0E-18
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 121 409 3.0E-18
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 119 409 3.0E-18
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 119 409 6.0E-18
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 119 409 1.0E-17
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 105 409 3.0E-17
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 121 409 3.0E-17
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 119 409 4.0E-17
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 105 409 5.0E-17
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 121 409 6.0E-17
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 121 409 1.0E-16
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 125 409 1.0E-16
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 121 409 2.0E-16
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 121 409 2.0E-16
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 14 409 5.0E-16
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 286 409 6.0E-16
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 105 409 6.0E-16
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 238 409 1.0E-15
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 121 409 2.0E-15
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 119 409 3.0E-15
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 139 409 3.0E-15
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 121 409 3.0E-15
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 124 409 4.0E-15
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 65 409 4.0E-15
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 159 409 5.0E-15
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 275 409 6.0E-15
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 121 409 9.0E-15
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 276 409 9.0E-15
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 276 409 1.0E-14
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 166 409 3.0E-14
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 121 409 3.0E-14
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 242 409 4.0E-14
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 80 409 4.0E-14
sp|Q54F47|C513C_DICDI Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 34 409 4.0E-14
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 121 409 4.0E-14
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 165 409 5.0E-14
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 275 409 9.0E-14
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 61 409 1.0E-13
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 127 409 2.0E-13
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 285 409 2.0E-13
sp|Q9NGX9|CP302_DROME Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 118 409 2.0E-13
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 28 409 2.0E-13
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 286 409 3.0E-13
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 168 409 4.0E-13
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 286 409 4.0E-13
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 42 408 5.0E-13
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 168 409 6.0E-13
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 121 409 7.0E-13
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 286 409 8.0E-13
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 286 409 8.0E-13
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 19 409 1.0E-12
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 54 409 1.0E-12
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 179 409 1.0E-12
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 168 409 2.0E-12
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 168 409 2.0E-12
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 291 409 3.0E-12
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 167 409 3.0E-12
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 165 409 5.0E-12
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 5 409 5.0E-12
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 38 409 5.0E-12
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 123 409 5.0E-12
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 168 409 6.0E-12
sp|Q64658|C11B2_MESAU Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 62 409 1.0E-11
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 100 409 1.0E-11
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 19 409 1.0E-11
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 232 409 1.0E-11
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 154 409 2.0E-11
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 69 408 2.0E-11
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 294 409 2.0E-11
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 176 409 2.0E-11
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 149 409 2.0E-11
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 103 409 2.0E-11
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 165 409 2.0E-11
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 14 408 3.0E-11
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 65 409 3.0E-11
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 65 409 3.0E-11
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 152 409 3.0E-11
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 168 409 3.0E-11
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 160 409 3.0E-11
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 125 409 3.0E-11
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 172 409 4.0E-11
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 259 409 4.0E-11
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 179 409 4.0E-11
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 125 409 4.0E-11
sp|B5UAQ8|C7195_ESCCA Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 298 409 4.0E-11
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 179 409 5.0E-11
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 125 409 5.0E-11
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 172 409 5.0E-11
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 214 409 5.0E-11
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 248 409 5.0E-11
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 168 409 5.0E-11
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 279 409 6.0E-11
sp|Q9VYT8|C28C1_DROME Probable cytochrome P450 28c1 OS=Drosophila melanogaster GN=Cyp28c1 PE=2 SV=1 207 409 7.0E-11
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 175 408 7.0E-11
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 286 409 7.0E-11
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 241 409 8.0E-11
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 104 407 8.0E-11
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 179 409 8.0E-11
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 168 409 9.0E-11
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 62 409 9.0E-11
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 168 409 9.0E-11
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 173 409 1.0E-10
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 242 409 1.0E-10
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 127 409 1.0E-10
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 183 409 1.0E-10
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 144 409 1.0E-10
sp|Q9LTL0|C71BQ_ARATH Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 55 409 1.0E-10
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 279 409 1.0E-10
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 173 409 1.0E-10
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 238 409 1.0E-10
sp|Q27756|CP6B3_PAPPO Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 200 409 1.0E-10
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 259 408 2.0E-10
sp|B1NF19|C719D_ARGME (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 299 409 2.0E-10
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 176 409 2.0E-10
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 30 409 2.0E-10
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 248 409 2.0E-10
sp|I7CT85|C7A53_PANGI Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 156 409 2.0E-10
sp|Q9VMS7|C4AC3_DROME Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 239 409 2.0E-10
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 167 409 2.0E-10
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 124 409 2.0E-10
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 149 409 2.0E-10
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 123 409 2.0E-10
sp|B1NF20|C719E_ARGME Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 255 409 3.0E-10
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 125 409 3.0E-10
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 298 409 4.0E-10
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 228 409 4.0E-10
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 42 409 4.0E-10
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 294 409 6.0E-10
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 4 409 6.0E-10
sp|Q50LH3|C7192_ESCCA (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 298 409 6.0E-10
sp|B1NF18|C719B_PAPSO Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 298 409 6.0E-10
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 286 409 6.0E-10
sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 46 409 7.0E-10
sp|P03940|CP21A_MOUSE Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 38 409 7.0E-10
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 295 409 7.0E-10
sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 26 409 7.0E-10
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 154 409 8.0E-10
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 123 409 8.0E-10
sp|O44221|CP4E5_DROMT Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 125 409 9.0E-10
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 129 409 9.0E-10
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 294 409 1.0E-09
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 283 409 1.0E-09
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 168 409 1.0E-09
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 34 409 1.0E-09
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 69 409 1.0E-09
sp|Q6VVW9|CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 294 409 1.0E-09
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 121 409 1.0E-09
sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 165 409 1.0E-09
sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 297 409 1.0E-09
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 294 409 1.0E-09
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 295 409 1.0E-09
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 297 409 1.0E-09
sp|Q6XVG2|CP254_MOUSE Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 294 407 1.0E-09
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 38 409 1.0E-09
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 38 409 1.0E-09
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 34 409 2.0E-09
sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 294 409 2.0E-09
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 286 409 2.0E-09
sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 63 409 2.0E-09
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 297 407 2.0E-09
sp|Q1ZXA4|C508D_DICDI Probable cytochrome P450 508D1 OS=Dictyostelium discoideum GN=cyp508D1 PE=3 SV=1 66 409 2.0E-09
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 279 409 2.0E-09
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 232 408 2.0E-09
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 62 409 2.0E-09
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 296 409 2.0E-09
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 167 409 2.0E-09
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 280 409 2.0E-09
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 55 409 3.0E-09
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 297 409 3.0E-09
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 286 409 3.0E-09
sp|Q54E98|C520B_DICDI Putative cytochrome P450 520B1 OS=Dictyostelium discoideum GN=cyp520B1 PE=5 SV=1 295 409 3.0E-09
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 263 409 3.0E-09
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 121 409 3.0E-09
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 134 409 3.0E-09
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 154 409 3.0E-09
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 168 409 4.0E-09
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 232 408 4.0E-09
sp|P92994|TCMO_ARATH Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1 197 409 4.0E-09
sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 292 409 4.0E-09
sp|P05182|CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 232 408 4.0E-09
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 172 409 5.0E-09
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 40 409 5.0E-09
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 259 409 5.0E-09
sp|Q1ZXN4|C519C_DICDI Probable cytochrome P450 519C1 OS=Dictyostelium discoideum GN=cyp519C1 PE=3 SV=1 80 409 5.0E-09
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 245 409 5.0E-09
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 143 409 5.0E-09
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 289 409 5.0E-09
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 295 409 6.0E-09
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 296 409 6.0E-09
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 63 409 6.0E-09
sp|P9WPM1|CP139_MYCTU Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 219 409 6.0E-09
sp|P9WPM0|CP139_MYCTO Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 219 409 6.0E-09
sp|P63720|CP139_MYCBO Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 219 409 6.0E-09
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 14 409 7.0E-09
sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 16 409 7.0E-09
sp|Q54CS3|C508C_DICDI Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 296 409 8.0E-09
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 246 409 8.0E-09
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 91 409 9.0E-09
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 289 409 9.0E-09
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 60 409 1.0E-08
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 279 409 1.0E-08
sp|P56590|CP1A1_CANLF Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 2 409 1.0E-08
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 125 409 1.0E-08
sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 179 408 1.0E-08
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 168 409 1.0E-08
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 168 409 1.0E-08
sp|Q9V979|CP6U1_DROME Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3 236 409 1.0E-08
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 275 409 1.0E-08
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 83 408 1.0E-08
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 65 409 1.0E-08
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 65 409 1.0E-08
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 104 407 1.0E-08
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 40 409 1.0E-08
sp|Q27594|CP6A9_DROME Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 286 408 1.0E-08
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 289 409 1.0E-08
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 154 409 2.0E-08
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 132 409 2.0E-08
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 82 409 2.0E-08
sp|Q50EK3|C04C1_PINTA Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 84 409 2.0E-08
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 289 409 2.0E-08
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 279 409 2.0E-08
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 297 409 2.0E-08
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 125 409 2.0E-08
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 294 409 2.0E-08
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 111 409 2.0E-08
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 297 407 2.0E-08
sp|Q91X77|CY250_MOUSE Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 297 407 2.0E-08
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 179 408 2.0E-08
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 159 409 2.0E-08
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 129 409 2.0E-08
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 69 409 2.0E-08
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 2 409 2.0E-08
sp|Q9VMS8|C4AC2_DROME Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 259 409 2.0E-08
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 252 409 3.0E-08
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 134 409 3.0E-08
sp|Q55BU9|C5133_DICDI Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 121 409 3.0E-08
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 275 408 3.0E-08
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 214 409 3.0E-08
sp|Q93ZB2|KO1_ARATH Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 255 409 3.0E-08
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 55 409 3.0E-08
sp|Q9V769|C6A22_DROME Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 159 409 3.0E-08
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 297 407 3.0E-08
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 104 409 3.0E-08
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 183 409 3.0E-08
sp|Q9V774|C6A21_DROME Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 179 408 3.0E-08
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 286 408 3.0E-08
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 297 408 3.0E-08
sp|P24453|CP1A2_MESAU Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 2 409 3.0E-08
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 296 409 3.0E-08
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 86 408 4.0E-08
sp|P33263|CP2CQ_MESAU Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 274 407 4.0E-08
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 154 409 4.0E-08
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 129 409 4.0E-08
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 289 409 4.0E-08
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 286 409 4.0E-08
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 297 407 4.0E-08
sp|Q43240|TCMO_ZINVI Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 197 409 4.0E-08
sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 2 409 4.0E-08
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 2 409 4.0E-08
sp|P15538|C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 75 409 4.0E-08
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 283 409 5.0E-08
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 288 409 5.0E-08
sp|Q1ZXG6|C5131_DICDI Probable cytochrome P450 513A1 OS=Dictyostelium discoideum GN=cyp513A1 PE=3 SV=1 118 409 5.0E-08
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 168 409 5.0E-08
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 162 409 5.0E-08
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 289 409 5.0E-08
sp|Q9FMV7|C94B1_ARATH Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 176 408 5.0E-08
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 227 409 6.0E-08
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 296 409 6.0E-08
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 294 409 6.0E-08
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 233 409 6.0E-08
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 247 408 6.0E-08
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 157 409 6.0E-08
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 235 409 6.0E-08
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 288 409 6.0E-08
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 62 409 6.0E-08
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 162 409 7.0E-08
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 283 409 7.0E-08
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 278 409 7.0E-08
sp|P79402|CP242_PIG Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 297 407 7.0E-08
sp|Q948Y1|C719A_COPJA (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 337 409 7.0E-08
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 287 409 8.0E-08
sp|Q501D8|C79B3_ARATH Tryptophan N-monooxygenase 2 OS=Arabidopsis thaliana GN=CYP79B3 PE=1 SV=1 14 409 8.0E-08
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 286 409 8.0E-08
sp|O46515|CP11A_HORSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 27 409 8.0E-08
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 160 409 8.0E-08
sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 258 409 8.0E-08
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 179 408 8.0E-08
sp|Q5Z5S6|C7019_ORYSJ Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 295 409 8.0E-08
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 297 408 8.0E-08
sp|O81345|C79B1_SINAL Cytochrome P450 79B1 OS=Sinapis alba GN=CYP79B1 PE=2 SV=1 179 409 8.0E-08
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 283 408 9.0E-08
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 65 409 9.0E-08
sp|Q9FUY7|C79F2_ARATH Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2 283 409 1.0E-07
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 295 409 1.0E-07
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 125 409 1.0E-07
sp|B8NHY4|ORDA_ASPFN O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 266 409 1.0E-07
sp|Q5VDD6|ORDA_ASPFL O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 266 409 1.0E-07
sp|P24903|CP2F1_HUMAN Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 249 408 1.0E-07
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 294 409 1.0E-07
sp|Q9VGH1|CP315_DROME Cytochrome P450 315a1, mitochondrial OS=Drosophila melanogaster GN=sad PE=2 SV=1 294 409 1.0E-07
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 273 409 1.0E-07
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 273 407 1.0E-07
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 297 407 1.0E-07
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 104 409 1.0E-07
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 279 409 1.0E-07
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 294 409 1.0E-07
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 32 409 1.0E-07
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 168 409 1.0E-07
sp|P33260|CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 297 407 1.0E-07
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 149 409 1.0E-07
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 124 409 2.0E-07
sp|Q27664|CP6B2_HELAM Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 291 409 2.0E-07
sp|Q556M4|C5082_DICDI Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 124 409 2.0E-07
sp|Q9VG40|CP134_DROME Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 82 408 2.0E-07
sp|P79716|CP1A1_DICLA Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 16 409 2.0E-07
sp|Q64391|CP1A2_CAVPO Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 179 409 2.0E-07
sp|P56655|CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 297 407 2.0E-07
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 288 409 2.0E-07
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 37 409 2.0E-07
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 261 356 2.0E-07
sp|P82713|CP392_DROME Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 260 409 2.0E-07
sp|P33264|CP2CR_MESAU Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 274 407 2.0E-07
sp|Q54SN0|C513E_DICDI Probable cytochrome P450 513E1 OS=Dictyostelium discoideum GN=cyp513E1 PE=3 SV=1 281 409 2.0E-07
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 60 409 2.0E-07
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 297 407 2.0E-07
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 212 408 2.0E-07
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 233 409 2.0E-07
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 233 409 2.0E-07
sp|P56594|CP2CL_CANLF Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 297 407 2.0E-07
sp|Q27712|CP2L1_PANAR Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 297 408 2.0E-07
sp|O13345|ORDA_ASPPA O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 266 409 2.0E-07
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 228 409 2.0E-07
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 129 409 2.0E-07
sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 297 407 2.0E-07
sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 286 409 2.0E-07
sp|Q54LA8|C555A_DICDI Probable cytochrome P450 555A1 OS=Dictyostelium discoideum GN=cyp555A1 PE=3 SV=1 281 409 2.0E-07
sp|Q05421|CP2E1_MOUSE Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 232 408 3.0E-07
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 233 408 3.0E-07
sp|Q04468|TCMO_HELTU Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 197 409 3.0E-07
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 286 409 3.0E-07
sp|P10632|CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 296 407 3.0E-07
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 165 409 3.0E-07
sp|Q5RBQ1|CP1A2_PONAB Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 181 409 3.0E-07
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 134 409 3.0E-07
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 297 409 3.0E-07
sp|Q29527|C11B1_PAPHU Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 125 409 3.0E-07
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 273 409 4.0E-07
sp|Q54SV9|C515B_DICDI Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515B1 PE=2 SV=1 294 409 4.0E-07
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 168 409 4.0E-07
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 212 408 4.0E-07
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 104 409 4.0E-07
sp|Q9SRQ1|C89A9_ARATH Cytochrome P450 89A9 OS=Arabidopsis thaliana GN=CYP89A9 PE=2 SV=1 65 409 4.0E-07
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 296 409 4.0E-07
sp|O81346|C79B2_ARATH Tryptophan N-monooxygenase 1 OS=Arabidopsis thaliana GN=CYP79B2 PE=1 SV=2 161 409 4.0E-07
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 125 409 4.0E-07
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 286 408 4.0E-07
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 238 409 4.0E-07
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 286 409 4.0E-07
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 294 409 4.0E-07
sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 295 409 4.0E-07
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 286 409 5.0E-07
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 168 409 5.0E-07
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 297 407 5.0E-07
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 283 409 5.0E-07
sp|Q43135|C79A1_SORBI Tyrosine N-monooxygenase OS=Sorghum bicolor GN=CYP79A1 PE=1 SV=3 286 409 5.0E-07
sp|Q9M7B7|C79D2_MANES Valine N-monooxygenase 2 OS=Manihot esculenta GN=CYP79D2 PE=1 SV=1 248 409 5.0E-07
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 168 409 5.0E-07
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 276 408 5.0E-07
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 297 409 5.0E-07
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 286 408 6.0E-07
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 297 408 6.0E-07
sp|Q949U1|C79F1_ARATH Dihomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F1 PE=1 SV=1 283 409 6.0E-07
sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 1 409 6.0E-07
sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 80 409 6.0E-07
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 169 409 6.0E-07
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 279 409 6.0E-07
sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 297 407 6.0E-07
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 154 409 6.0E-07
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 168 409 7.0E-07
sp|P33266|CP2E1_MACFA Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 232 408 7.0E-07
sp|Q54WB9|C513D_DICDI Probable cytochrome P450 513D1 OS=Dictyostelium discoideum GN=cyp513D1 PE=3 SV=1 225 409 7.0E-07
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 290 409 7.0E-07
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 227 409 7.0E-07
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 295 409 8.0E-07
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 297 407 8.0E-07
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 294 409 8.0E-07
sp|Q9EPT4|CP11A_MESAU Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 134 409 8.0E-07
sp|Q54PT3|C556A_DICDI Probable cytochrome P450 556A1 OS=Dictyostelium discoideum GN=cyp556A1 PE=3 SV=1 80 409 9.0E-07
sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 46 409 9.0E-07
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 138 408 9.0E-07
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 295 409 1.0E-06
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 179 409 1.0E-06
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 125 409 1.0E-06
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 168 409 1.0E-06
sp|Q9VHP4|CP313_DROME Probable cytochrome P450 313b1 OS=Drosophila melanogaster GN=Cyp313b1 PE=2 SV=2 82 406 1.0E-06
sp|Q9PUB4|CP26A_CHICK Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 274 409 1.0E-06
sp|P04798|CP1A1_HUMAN Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 227 409 1.0E-06
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 125 409 1.0E-06
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 168 409 1.0E-06
sp|P20678|CP2H2_CHICK Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 60 407 1.0E-06
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 169 409 1.0E-06
sp|P19099|C11B2_HUMAN Cytochrome P450 11B2, mitochondrial OS=Homo sapiens GN=CYP11B2 PE=1 SV=3 125 409 1.0E-06
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 209 408 1.0E-06
sp|P56592|CP1A2_CANLF Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 6 409 1.0E-06
sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 139 409 1.0E-06
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 294 408 1.0E-06
sp|P05178|CP2C6_RAT Cytochrome P450 2C6 OS=Rattus norvegicus GN=Cyp2c6 PE=2 SV=2 297 407 1.0E-06
sp|Q9V3S0|CP4G1_DROME Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 282 408 1.0E-06
sp|Q05JG2|ABAH1_ORYSJ Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP707A5 PE=2 SV=1 210 409 1.0E-06
sp|Q09J79|ABAH1_ORYSI Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. indica GN=CYP707A5 PE=2 SV=1 210 409 1.0E-06
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 280 409 1.0E-06
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 169 409 2.0E-06
sp|P9WPM9|C135B_MYCTU Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135B1 PE=1 SV=1 277 409 2.0E-06
sp|P9WPM8|C135B_MYCTO Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135B1 PE=3 SV=1 277 409 2.0E-06
sp|P63716|C135B_MYCBO Putative cytochrome P450 135B1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp135B1 PE=3 SV=1 277 409 2.0E-06
sp|O80823|C86A8_ARATH Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 168 409 2.0E-06
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 227 409 2.0E-06
sp|P08683|CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 297 407 2.0E-06
sp|Q9VWR5|CP306_DROME Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 297 409 2.0E-06
sp|P33262|CP2CK_MACFA Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 296 407 2.0E-06
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 286 409 2.0E-06
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 62 409 2.0E-06
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 209 408 2.0E-06
sp|P30609|CP52G_CANTR Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 164 360 2.0E-06
sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 291 409 2.0E-06
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 291 407 2.0E-06
sp|P79739|CP26A_DANRE Cytochrome P450 26A1 OS=Danio rerio GN=cyp26a1 PE=2 SV=1 278 409 2.0E-06
sp|Q29473|CP2DF_CANLF Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 290 408 2.0E-06
sp|P24455|CP2A9_MESAU Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 62 408 2.0E-06
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 179 409 2.0E-06
sp|P19225|CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 297 407 3.0E-06
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 209 408 3.0E-06
sp|A1DA63|FTME_NEOFI Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 298 409 3.0E-06
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 168 409 3.0E-06
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 245 409 3.0E-06
sp|P30612|CP52P_CANTR Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 175 409 3.0E-06
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 235 409 4.0E-06
sp|O65785|C71B3_ARATH Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2 62 409 4.0E-06
sp|Q6EIG3|CP26B_DANRE Cytochrome P450 26B1 OS=Danio rerio GN=cyp26b1 PE=1 SV=1 121 409 4.0E-06
sp|P20814|CP2CD_RAT Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 297 407 4.0E-06
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 26 409 5.0E-06
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 291 409 5.0E-06
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 61 409 5.0E-06
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 297 407 6.0E-06
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 125 409 6.0E-06
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 48 409 6.0E-06
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 168 409 6.0E-06
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 37 409 6.0E-06
sp|Q43250|C71C1_MAIZE 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 166 409 6.0E-06
sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 209 408 6.0E-06
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 295 409 7.0E-06
sp|P24457|CP2DB_MOUSE Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 209 408 9.0E-06
sp|Q9AXH9|KAO1_HORVU Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 286 409 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|667
MEHLTANAIYCGGAIICVIAVAQYIYAGLTNTLSHVPGPWYTRFTSLPSTAFVILAHHPEWVHALHARYGPVVRI
SPHEVDVADPSAAQRIHRARSGFLKSPFYSLLITDSSSVFNEIRPEVHRKYKRLLTGPMSETGLKAFLPRIDGKV
RLAIDRMRSENKIRGAADIAKWFMFLSFDIIGDLTFGESFGQLESGRKTQSVDDFVSLGFVGGLRSMFPTIAKIS
LFLPIPVFRNATKIQYRTFDYAEKALSRHRTRVEQTGSDLRPTVFSRLYTAEAEETWSPIEIRDNAQVFIVGGSD
TTANSMIYLIWAVCKIPQVKAKLLKELEILQQGYGYEDLRDKSYLNCIVNETLRLYTALPAGLPRLVPTGGAELA
GHFIPEGATVMTQAYSLHRDENAFPDPYRFYPER*
Coding >Hirsu2|667
ATGGAACACCTCACGGCGAACGCCATCTATTGCGGCGGTGCCATTATATGCGTCATCGCCGTTGCGCAGTACATA
TATGCCGGCCTAACAAACACTCTATCCCATGTCCCAGGCCCGTGGTATACGAGATTTACCAGCCTGCCGTCAACC
GCATTCGTTATCTTGGCCCATCACCCGGAATGGGTGCACGCCCTCCACGCAAGATATGGCCCCGTCGTGCGCATC
AGCCCGCACGAGGTCGACGTCGCGGACCCTTCGGCCGCCCAGCGTATCCACCGTGCCCGGAGCGGCTTCCTAAAG
TCCCCTTTCTACTCGCTGCTTATCACCGACTCATCTAGCGTCTTTAACGAGATCAGGCCCGAAGTTCACCGCAAG
TACAAGCGTCTCCTCACGGGCCCTATGTCAGAGACGGGCCTCAAGGCCTTCCTACCGCGCATTGACGGGAAAGTA
CGCCTCGCCATCGATCGCATGCGCTCTGAGAACAAGATCCGCGGCGCTGCCGACATTGCTAAGTGGTTCATGTTT
CTCTCCTTTGATATCATCGGCGACTTGACCTTTGGCGAGTCATTTGGCCAACTTGAGAGCGGCCGAAAGACGCAG
TCCGTCGACGACTTCGTAAGCTTGGGCTTCGTGGGCGGCTTGCGCTCCATGTTCCCAACCATTGCCAAAATATCG
TTGTTCTTGCCAATACCCGTCTTCAGAAACGCGACCAAGATTCAGTACCGAACTTTTGACTACGCTGAAAAGGCT
TTGAGCCGTCATCGCACACGCGTCGAGCAGACAGGCTCCGATCTCCGCCCCACTGTCTTCTCTAGGCTCTACACA
GCCGAGGCCGAGGAGACCTGGTCACCCATCGAGATTCGCGACAACGCTCAAGTCTTCATTGTTGGCGGCAGCGAC
ACGACGGCGAATTCCATGATATATCTCATTTGGGCCGTCTGCAAGATACCCCAGGTTAAGGCCAAGCTTCTTAAA
GAACTCGAAATCCTACAACAGGGCTATGGCTACGAAGATTTAAGGGATAAGTCGTACCTAAACTGCATCGTCAAC
GAGACTCTGCGTCTTTACACGGCTCTACCCGCTGGTCTTCCCAGACTCGTACCTACCGGGGGGGCCGAGCTCGCG
GGACACTTTATTCCGGAGGGCGCGACCGTCATGACGCAGGCATACAGCTTGCATCGCGACGAGAATGCCTTCCCG
GACCCATACCGCTTCTATCCCGAACGCTAG
Transcript >Hirsu2|667
ATGGAACACCTCACGGCGAACGCCATCTATTGCGGCGGTGCCATTATATGCGTCATCGCCGTTGCGCAGTACATA
TATGCCGGCCTAACAAACACTCTATCCCATGTCCCAGGCCCGTGGTATACGAGATTTACCAGCCTGCCGTCAACC
GCATTCGTTATCTTGGCCCATCACCCGGAATGGGTGCACGCCCTCCACGCAAGATATGGCCCCGTCGTGCGCATC
AGCCCGCACGAGGTCGACGTCGCGGACCCTTCGGCCGCCCAGCGTATCCACCGTGCCCGGAGCGGCTTCCTAAAG
TCCCCTTTCTACTCGCTGCTTATCACCGACTCATCTAGCGTCTTTAACGAGATCAGGCCCGAAGTTCACCGCAAG
TACAAGCGTCTCCTCACGGGCCCTATGTCAGAGACGGGCCTCAAGGCCTTCCTACCGCGCATTGACGGGAAAGTA
CGCCTCGCCATCGATCGCATGCGCTCTGAGAACAAGATCCGCGGCGCTGCCGACATTGCTAAGTGGTTCATGTTT
CTCTCCTTTGATATCATCGGCGACTTGACCTTTGGCGAGTCATTTGGCCAACTTGAGAGCGGCCGAAAGACGCAG
TCCGTCGACGACTTCGTAAGCTTGGGCTTCGTGGGCGGCTTGCGCTCCATGTTCCCAACCATTGCCAAAATATCG
TTGTTCTTGCCAATACCCGTCTTCAGAAACGCGACCAAGATTCAGTACCGAACTTTTGACTACGCTGAAAAGGCT
TTGAGCCGTCATCGCACACGCGTCGAGCAGACAGGCTCCGATCTCCGCCCCACTGTCTTCTCTAGGCTCTACACA
GCCGAGGCCGAGGAGACCTGGTCACCCATCGAGATTCGCGACAACGCTCAAGTCTTCATTGTTGGCGGCAGCGAC
ACGACGGCGAATTCCATGATATATCTCATTTGGGCCGTCTGCAAGATACCCCAGGTTAAGGCCAAGCTTCTTAAA
GAACTCGAAATCCTACAACAGGGCTATGGCTACGAAGATTTAAGGGATAAGTCGTACCTAAACTGCATCGTCAAC
GAGACTCTGCGTCTTTACACGGCTCTACCCGCTGGTCTTCCCAGACTCGTACCTACCGGGGGGGCCGAGCTCGCG
GGACACTTTATTCCGGAGGGCGCGACCGTCATGACGCAGGCATACAGCTTGCATCGCGACGAGAATGCCTTCCCG
GACCCATACCGCTTCTATCCCGAACGCTAG
Gene >Hirsu2|667
ATGGAACACCTCACGGCGAACGCCATCTATTGCGGCGGTGCCATTATATGCGTCATCGCCGTTGCGGTAGGTGCG
ACATATCAATGTGGTCGCGTAGAAGCGCTGTCATATATCTGAATCTTCGGCGGACTAACACCAACGACAATATCC
AGCAGTACATATATGCCGGCCTAACAAACACTCTATCCCATGTCCCAGGCCCGTGGTATACGAGATTTACCAGCC
TGCCGTCAACCGCATTCGTTATCTTGGCCCATCACCCGGAATGGGTGCACGCCCTCCACGCAAGATATGGCCCCG
TCGTGCGCATCAGCCCGCACGAGGTCGACGTCGCGGACCCTTCGGCCGCCCAGCGTATCCACCGTGCCCGGAGCG
GCTTCCTAAAGTCCCCTTTCTACTCGCTGCTTATCACCGACTCATCTAGCGTCTTTAACGAGATCAGGCCCGAAG
TTCACCGCAAGTACAAGCGTCTCCTCACGGGCCCTATGTCAGAGACGGGCCTCAAGGCCTTCCTACCGCGCATTG
ACGGGAAAGTACGCCTCGCCATCGATCGCATGCGCTCTGAGAACAAGATCCGCGGCGCTGCCGACATTGCTAAGT
GGTTCATGTTTCTCTCCTTTGATATCATCGGCGACTTGACCTTTGGCGAGTCATTTGGCCAACTTGAGAGCGGCC
GAAAGACGCAGTCCGTCGACGACTTCGTAAGCTTGGGCTTCGTGGGCGGCTTGCGCTCCATGTTCCCAACCATTG
CCAAAATATCGTTGTTCTTGCCAATACCCGTCTTCAGAAACGCGACCAAGATTCAGTACCGAACTTTTGACTACG
CTGAAAAGGCTTTGAGCCGTCATCGCACACGCGTCGAGCAGACAGGCTCCGATCTCCGCCCCACTGTCTTCTCTA
GGCTCTACACAGCCGAGGCCGAGGAGACCTGGTCACCCATCGAGATTCGCGACAACGCTCAAGTCTTCATTGTTG
GCGGCAGCGACACGACGGCGAATTCCATGATATATCTCATTTGGGCCGTCTGCAAGATACCCCAGGTTAAGGCCA
AGCTTCTTAAAGAACTCGAAATCCTACAACAGGGCTATGGCTACGAAGATTTAAGGGATAAGTCGTACCTAAACT
GCATCGTCAACGAGACTCTGCGTCTTTACACGGCTCTACCCGCTGGTCTTCCCAGACTCGTACCTACCGGGGGGG
CCGAGCTCGCGGGACACTTTATTCCGGAGGGCGCGACCGTCATGACGCAGGCATACAGCTTGCATCGCGACGAGA
ATGCCTTCCCGGACCCATACCGCTTCTATCCCGAACGGTGGGAGGCGACGAGCCAACTAATGAAGGATTGTACTA
TGCCCTTTGGCGGGGGCTCCAGGAGTAAGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail