© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|667 |
| Gene name | |
| Location | Contig_1133:606..1989 |
| Strand | - |
| Gene length (bp) | 1383 |
| Transcript length (bp) | 1230 |
| Coding sequence length (bp) | 1230 |
| Protein length (aa) | 410 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00067 | p450 | Cytochrome P450 | 5.6E-47 | 60 | 409 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12608|STCB_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 | 7 | 405 | 8.0E-55 |
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 33 | 409 | 1.0E-38 |
| sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 33 | 409 | 5.0E-37 |
| sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 24 | 409 | 4.0E-35 |
| sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 25 | 409 | 4.0E-35 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12608|STCB_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 | 7 | 405 | 8.0E-55 |
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 33 | 409 | 1.0E-38 |
| sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 33 | 409 | 5.0E-37 |
| sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 24 | 409 | 4.0E-35 |
| sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 25 | 409 | 4.0E-35 |
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 25 | 409 | 4.0E-35 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 25 | 409 | 4.0E-35 |
| sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 33 | 409 | 4.0E-34 |
| sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 24 | 409 | 8.0E-33 |
| sp|Q12732|AVNA_ASPPA | Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 | 62 | 409 | 1.0E-30 |
| sp|Q9UW95|AFLL_ASPPA | Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 | 14 | 409 | 4.0E-30 |
| sp|Q00707|STCL_EMENI | Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 | 13 | 409 | 1.0E-29 |
| sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 125 | 409 | 1.0E-19 |
| sp|O00061|CP67_UROFA | Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 | 69 | 409 | 6.0E-19 |
| sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 105 | 409 | 1.0E-18 |
| sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 119 | 409 | 2.0E-18 |
| sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 121 | 409 | 3.0E-18 |
| sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 119 | 409 | 3.0E-18 |
| sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 119 | 409 | 6.0E-18 |
| sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 119 | 409 | 1.0E-17 |
| sp|O18993|CP3AL_CALJA | Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 | 105 | 409 | 3.0E-17 |
| sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 121 | 409 | 3.0E-17 |
| sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 119 | 409 | 4.0E-17 |
| sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 105 | 409 | 5.0E-17 |
| sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 121 | 409 | 6.0E-17 |
| sp|O09158|CP3AP_MOUSE | Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 | 121 | 409 | 1.0E-16 |
| sp|Q9VYQ7|CP311_DROME | Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 | 125 | 409 | 1.0E-16 |
| sp|P20815|CP3A5_HUMAN | Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 | 121 | 409 | 2.0E-16 |
| sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 121 | 409 | 2.0E-16 |
| sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 14 | 409 | 5.0E-16 |
| sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 286 | 409 | 6.0E-16 |
| sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 105 | 409 | 6.0E-16 |
| sp|Q9SBQ9|F3PH_PETHY | Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 | 238 | 409 | 1.0E-15 |
| sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 121 | 409 | 2.0E-15 |
| sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 119 | 409 | 3.0E-15 |
| sp|Q9W011|C4D20_DROME | Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 | 139 | 409 | 3.0E-15 |
| sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 121 | 409 | 3.0E-15 |
| sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 124 | 409 | 4.0E-15 |
| sp|Q12612|TRI4_FUSSP | Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 | 65 | 409 | 4.0E-15 |
| sp|Q9VB31|C6A18_DROME | Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 | 159 | 409 | 5.0E-15 |
| sp|A2RRT9|CP4V2_RAT | Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 | 275 | 409 | 6.0E-15 |
| sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 121 | 409 | 9.0E-15 |
| sp|Q8AXY5|C356_FUNHE | Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 | 276 | 409 | 9.0E-15 |
| sp|Q9PVE8|C330_FUNHE | Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 | 276 | 409 | 1.0E-14 |
| sp|Q43068|C82A1_PEA | Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | 166 | 409 | 3.0E-14 |
| sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 121 | 409 | 3.0E-14 |
| sp|Q55AJ4|C516B_DICDI | Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 | 242 | 409 | 4.0E-14 |
| sp|P29980|CPXN_NOSS1 | Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 | 80 | 409 | 4.0E-14 |
| sp|Q54F47|C513C_DICDI | Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 | 34 | 409 | 4.0E-14 |
| sp|Q64581|CP3AI_RAT | Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 | 121 | 409 | 4.0E-14 |
| sp|Q9Y757|CP52L_DEBHN | Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 | 165 | 409 | 5.0E-14 |
| sp|Q9DBW0|CP4V2_MOUSE | Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 | 275 | 409 | 9.0E-14 |
| sp|Q9VXY0|CP4S3_DROME | Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 | 61 | 409 | 1.0E-13 |
| sp|O46054|C4AE1_DROME | Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 | 127 | 409 | 2.0E-13 |
| sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 285 | 409 | 2.0E-13 |
| sp|Q9NGX9|CP302_DROME | Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 | 118 | 409 | 2.0E-13 |
| sp|Q64441|CP24A_MOUSE | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 | 28 | 409 | 2.0E-13 |
| sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 286 | 409 | 3.0E-13 |
| sp|F2Z9C1|P6H_ESCCA | Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 | 168 | 409 | 4.0E-13 |
| sp|Q6ZWL3|CP4V2_HUMAN | Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 | 286 | 409 | 4.0E-13 |
| sp|P24464|CP4AC_RAT | Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 | 42 | 408 | 5.0E-13 |
| sp|P10615|CP52A_CANTR | Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 | 168 | 409 | 6.0E-13 |
| sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 121 | 409 | 7.0E-13 |
| sp|Q27593|CP6A8_DROME | Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 | 286 | 409 | 8.0E-13 |
| sp|Q5RCN6|CP4V2_PONAB | Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 | 286 | 409 | 8.0E-13 |
| sp|Q07973|CP24A_HUMAN | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 | 19 | 409 | 1.0E-12 |
| sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 54 | 409 | 1.0E-12 |
| sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 179 | 409 | 1.0E-12 |
| sp|Q12589|CP52K_CANMA | Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 | 168 | 409 | 2.0E-12 |
| sp|Q12581|CP52X_CANMA | Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 | 168 | 409 | 2.0E-12 |
| sp|P33270|CP6A2_DROME | Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 | 291 | 409 | 3.0E-12 |
| sp|O49858|C82A3_SOYBN | Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 | 167 | 409 | 3.0E-12 |
| sp|O81972|C82A2_SOYBN | Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 | 165 | 409 | 5.0E-12 |
| sp|Q9V7G5|C4AA1_DROME | Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 | 5 | 409 | 5.0E-12 |
| sp|P15540|CP21A_PIG | Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 | 38 | 409 | 5.0E-12 |
| sp|Q556M5|C5081_DICDI | Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 | 123 | 409 | 5.0E-12 |
| sp|Q12588|CP52J_CANMA | Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 | 168 | 409 | 6.0E-12 |
| sp|Q64658|C11B2_MESAU | Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 | 62 | 409 | 1.0E-11 |
| sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 100 | 409 | 1.0E-11 |
| sp|Q09128|CP24A_RAT | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 | 19 | 409 | 1.0E-11 |
| sp|Q9VS79|CP4D8_DROME | Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 | 232 | 409 | 1.0E-11 |
| sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 154 | 409 | 2.0E-11 |
| sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 69 | 408 | 2.0E-11 |
| sp|Q8VWZ7|C76B6_CATRO | Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 | 294 | 409 | 2.0E-11 |
| sp|F4JW83|C84A4_ARATH | Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 | 176 | 409 | 2.0E-11 |
| sp|D4AY62|A1131_ARTBC | Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 | 149 | 409 | 2.0E-11 |
| sp|Q9V771|C6A23_DROME | Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 | 103 | 409 | 2.0E-11 |
| sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 165 | 409 | 2.0E-11 |
| sp|Q964T1|CP4CU_BLAGE | Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 | 14 | 408 | 3.0E-11 |
| sp|P49430|THAS_RAT | Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 | 65 | 409 | 3.0E-11 |
| sp|O64637|C76C2_ARATH | Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 | 65 | 409 | 3.0E-11 |
| sp|Q9LTL2|C71BP_ARATH | Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 | 152 | 409 | 3.0E-11 |
| sp|P48416|CP10_LYMST | Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 | 168 | 409 | 3.0E-11 |
| sp|O22203|C98A3_ARATH | Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 | 160 | 409 | 3.0E-11 |
| sp|P15393|C11B1_RAT | Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 | 125 | 409 | 3.0E-11 |
| sp|P33269|CP4D1_DROME | Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 | 172 | 409 | 4.0E-11 |
| sp|Q9VLZ7|C4D21_DROME | Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 | 259 | 409 | 4.0E-11 |
| sp|Q0IIF9|CP2U1_BOVIN | Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 | 179 | 409 | 4.0E-11 |
| sp|P30100|C11B3_RAT | Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 | 125 | 409 | 4.0E-11 |
| sp|B5UAQ8|C7195_ESCCA | Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 | 298 | 409 | 4.0E-11 |
| sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 179 | 409 | 5.0E-11 |
| sp|P30099|C11B2_RAT | Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 | 125 | 409 | 5.0E-11 |
| sp|O16805|CP4D1_DROSI | Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 | 172 | 409 | 5.0E-11 |
| sp|Q6VVX0|CP2R1_HUMAN | Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 | 214 | 409 | 5.0E-11 |
| sp|H2DH24|C7D47_PANGI | Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 | 248 | 409 | 5.0E-11 |
| sp|P30608|CP52F_CANTR | Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 | 168 | 409 | 5.0E-11 |
| sp|P24458|CP52E_CANMA | Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 | 279 | 409 | 6.0E-11 |
| sp|Q9VYT8|C28C1_DROME | Probable cytochrome P450 28c1 OS=Drosophila melanogaster GN=Cyp28c1 PE=2 SV=1 | 207 | 409 | 7.0E-11 |
| sp|Q9MZY0|CP2E1_CANLF | Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 | 175 | 408 | 7.0E-11 |
| sp|O46051|C4D14_DROME | Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 | 286 | 409 | 7.0E-11 |
| sp|Q9SD85|F3PH_ARATH | Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 | 241 | 409 | 8.0E-11 |
| sp|P14580|CP4A6_RABIT | Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 | 104 | 407 | 8.0E-11 |
| sp|Q9V770|C6A17_DROME | Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 | 179 | 409 | 8.0E-11 |
| sp|P30607|CP52B_CANTR | Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 | 168 | 409 | 9.0E-11 |
| sp|P15539|C11B2_MOUSE | Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 | 62 | 409 | 9.0E-11 |
| sp|Q964Q7|CP6D3_MUSDO | Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 | 168 | 409 | 9.0E-11 |
| sp|Q9LHA1|C8D11_ARATH | Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 | 173 | 409 | 1.0E-10 |
| sp|Q6R7M4|C15A1_DIPPU | Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 | 242 | 409 | 1.0E-10 |
| sp|O48928|C77A3_SOYBN | Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 | 127 | 409 | 1.0E-10 |
| sp|P93147|C81E1_GLYEC | Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 | 183 | 409 | 1.0E-10 |
| sp|P08686|CP21A_HUMAN | Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 | 144 | 409 | 1.0E-10 |
| sp|Q9LTL0|C71BQ_ARATH | Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 | 55 | 409 | 1.0E-10 |
| sp|P16496|CP52C_CANMA | Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 | 279 | 409 | 1.0E-10 |
| sp|P37122|C76A2_SOLME | Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 | 173 | 409 | 1.0E-10 |
| sp|Q6WNQ8|C81E8_MEDTR | Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 | 238 | 409 | 1.0E-10 |
| sp|Q27756|CP6B3_PAPPO | Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 | 200 | 409 | 1.0E-10 |
| sp|Q9VA27|CP4C3_DROME | Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 | 259 | 408 | 2.0E-10 |
| sp|B1NF19|C719D_ARGME | (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 | 299 | 409 | 2.0E-10 |
| sp|O48922|C98A2_SOYBN | Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 | 176 | 409 | 2.0E-10 |
| sp|Q9T0K0|C71AJ_ARATH | Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 | 30 | 409 | 2.0E-10 |
| sp|Q9SZ46|C82C4_ARATH | Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 | 248 | 409 | 2.0E-10 |
| sp|I7CT85|C7A53_PANGI | Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 | 156 | 409 | 2.0E-10 |
| sp|Q9VMS7|C4AC3_DROME | Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 | 239 | 409 | 2.0E-10 |
| sp|Q9VCW1|CP6D4_DROME | Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 | 167 | 409 | 2.0E-10 |
| sp|Q9FG65|C81D1_ARATH | Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 | 124 | 409 | 2.0E-10 |
| sp|O64635|C76C4_ARATH | Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 | 149 | 409 | 2.0E-10 |
| sp|Q82IY3|PTLI_STRAW | Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 | 123 | 409 | 2.0E-10 |
| sp|B1NF20|C719E_ARGME | Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 | 255 | 409 | 3.0E-10 |
| sp|P14579|CP4A5_RABIT | Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 | 125 | 409 | 3.0E-10 |
| sp|Q50LH4|C7193_ESCCA | (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 | 298 | 409 | 4.0E-10 |
| sp|Q50EK4|C75A1_PINTA | Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 | 228 | 409 | 4.0E-10 |
| sp|Q91WL5|CP4CA_MOUSE | Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 | 42 | 409 | 4.0E-10 |
| sp|D1MI46|C76BA_SWEMU | Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 | 294 | 409 | 6.0E-10 |
| sp|Q9LJY7|C75AK_ARATH | Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 | 4 | 409 | 6.0E-10 |
| sp|Q50LH3|C7192_ESCCA | (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 | 298 | 409 | 6.0E-10 |
| sp|B1NF18|C719B_PAPSO | Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 | 298 | 409 | 6.0E-10 |
| sp|O23365|C97B3_ARATH | Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 | 286 | 409 | 6.0E-10 |
| sp|Q9LTM6|C71BH_ARATH | Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 | 46 | 409 | 7.0E-10 |
| sp|P03940|CP21A_MOUSE | Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 | 38 | 409 | 7.0E-10 |
| sp|P48421|C83A1_ARATH | Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 | 295 | 409 | 7.0E-10 |
| sp|P93530|C71D6_SOLCH | Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 | 26 | 409 | 7.0E-10 |
| sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 154 | 409 | 8.0E-10 |
| sp|B5BSX1|BAMO_GLYUR | Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 | 123 | 409 | 8.0E-10 |
| sp|O44221|CP4E5_DROMT | Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 | 125 | 409 | 9.0E-10 |
| sp|O49342|C71AD_ARATH | Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 | 129 | 409 | 9.0E-10 |
| sp|O48956|C98A1_SORBI | Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 | 294 | 409 | 1.0E-09 |
| sp|P15128|CP4B1_RABIT | Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 | 283 | 409 | 1.0E-09 |
| sp|L7X0L7|P6H_PAPSO | Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 | 168 | 409 | 1.0E-09 |
| sp|Q9Y6A2|CP46A_HUMAN | Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 | 34 | 409 | 1.0E-09 |
| sp|Q6TBX7|LUT1_ARATH | Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 | 69 | 409 | 1.0E-09 |
| sp|Q6VVW9|CP2R1_MOUSE | Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 | 294 | 409 | 1.0E-09 |
| sp|P00191|CP21A_BOVIN | Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 | 121 | 409 | 1.0E-09 |
| sp|O49859|C82A4_SOYBN | Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 | 165 | 409 | 1.0E-09 |
| sp|O65786|C71B4_ARATH | Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 | 297 | 409 | 1.0E-09 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 294 | 409 | 1.0E-09 |
| sp|Q9STL1|C71AM_ARATH | Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 | 295 | 409 | 1.0E-09 |
| sp|Q6Z5I7|C76M6_ORYSJ | Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 | 297 | 409 | 1.0E-09 |
| sp|Q6XVG2|CP254_MOUSE | Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 | 294 | 407 | 1.0E-09 |
| sp|Q2LCM1|CP21A_CANLU | Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 | 38 | 409 | 1.0E-09 |
| sp|Q8WNW0|CP21A_CANLF | Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 | 38 | 409 | 1.0E-09 |
| sp|Q9WVK8|CP46A_MOUSE | Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 | 34 | 409 | 2.0E-09 |
| sp|Q9CA61|C98A8_ARATH | Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 | 294 | 409 | 2.0E-09 |
| sp|Q2KIG5|THAS_BOVIN | Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 | 286 | 409 | 2.0E-09 |
| sp|Q9XHE7|C71DD_MENPI | Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 | 63 | 409 | 2.0E-09 |
| sp|P56654|CP237_MOUSE | Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 | 297 | 407 | 2.0E-09 |
| sp|Q1ZXA4|C508D_DICDI | Probable cytochrome P450 508D1 OS=Dictyostelium discoideum GN=cyp508D1 PE=3 SV=1 | 66 | 409 | 2.0E-09 |
| sp|Q6YV88|C71Z7_ORYSJ | Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 | 279 | 409 | 2.0E-09 |
| sp|P79383|CP2E1_PIG | Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 | 232 | 408 | 2.0E-09 |
| sp|O04164|C71A6_NEPRA | Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 | 62 | 409 | 2.0E-09 |
| sp|Q6YTF1|C76M8_ORYSJ | Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 | 296 | 409 | 2.0E-09 |
| sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 167 | 409 | 2.0E-09 |
| sp|O65790|C81F1_ARATH | Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 | 280 | 409 | 2.0E-09 |
| sp|Q9STK7|C71AQ_ARATH | Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 | 55 | 409 | 3.0E-09 |
| sp|Q6YTF5|C76M5_ORYSJ | Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 | 297 | 409 | 3.0E-09 |
| sp|Q9V4U9|C6A13_DROME | Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 | 286 | 409 | 3.0E-09 |
| sp|Q54E98|C520B_DICDI | Putative cytochrome P450 520B1 OS=Dictyostelium discoideum GN=cyp520B1 PE=5 SV=1 | 295 | 409 | 3.0E-09 |
| sp|Q04552|CP6B1_PAPPO | Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 | 263 | 409 | 3.0E-09 |
| sp|O23051|KAO1_ARATH | Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 | 121 | 409 | 3.0E-09 |
| sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 134 | 409 | 3.0E-09 |
| sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 154 | 409 | 3.0E-09 |
| sp|Q09653|C13AA_CAEEL | Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 | 168 | 409 | 4.0E-09 |
| sp|P51581|CP2E1_MESAU | Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 | 232 | 408 | 4.0E-09 |
| sp|P92994|TCMO_ARATH | Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1 | 197 | 409 | 4.0E-09 |
| sp|Q9LTL8|C71BO_ARATH | Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 | 292 | 409 | 4.0E-09 |
| sp|P05182|CP2E1_RAT | Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 | 232 | 408 | 4.0E-09 |
| sp|L7X3S1|MSH_PAPSO | Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 | 172 | 409 | 5.0E-09 |
| sp|Q2LA60|CP21A_FELCA | Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 | 40 | 409 | 5.0E-09 |
| sp|Q9K498|EIZFM_STRCO | Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 | 259 | 409 | 5.0E-09 |
| sp|Q1ZXN4|C519C_DICDI | Probable cytochrome P450 519C1 OS=Dictyostelium discoideum GN=cyp519C1 PE=3 SV=1 | 80 | 409 | 5.0E-09 |
| sp|Q9GQM9|CP6L1_BLAGE | Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 | 245 | 409 | 5.0E-09 |
| sp|Q9VVR9|C12C1_DROME | Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 | 143 | 409 | 5.0E-09 |
| sp|D5JBW9|GAO_SAUCO | Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 | 289 | 409 | 5.0E-09 |
| sp|P58048|C71B8_ARATH | Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 | 295 | 409 | 6.0E-09 |
| sp|Q69X58|C76M7_ORYSJ | Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 | 296 | 409 | 6.0E-09 |
| sp|Q42799|C93A2_SOYBN | Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 | 63 | 409 | 6.0E-09 |
| sp|P9WPM1|CP139_MYCTU | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 | 219 | 409 | 6.0E-09 |
| sp|P9WPM0|CP139_MYCTO | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 | 219 | 409 | 6.0E-09 |
| sp|P63720|CP139_MYCBO | Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 | 219 | 409 | 6.0E-09 |
| sp|Q9FMY1|C86B1_ARATH | Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 | 14 | 409 | 7.0E-09 |
| sp|Q92095|CP1A1_OPSTA | Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 | 16 | 409 | 7.0E-09 |
| sp|Q54CS3|C508C_DICDI | Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 | 296 | 409 | 8.0E-09 |
| sp|C0SJS3|ANGS_PASSA | Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 | 246 | 409 | 8.0E-09 |
| sp|P9WPN3|CP132_MYCTU | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 | 91 | 409 | 9.0E-09 |
| sp|D5J9U8|GAO_LACSA | Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 | 289 | 409 | 9.0E-09 |
| sp|P9WPN2|CP132_MYCTO | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 | 168 | 409 | 1.0E-08 |
| sp|P59954|CP132_MYCBO | Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 | 168 | 409 | 1.0E-08 |
| sp|Q9V979|CP6U1_DROME | Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3 | 236 | 409 | 1.0E-08 |
| sp|Q27698|CP6D1_MUSDO | Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 | 275 | 409 | 1.0E-08 |
| sp|P10611|CP4A4_RABIT | Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 | 83 | 408 | 1.0E-08 |
| sp|O81117|C94A1_VICSA | Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 | 65 | 409 | 1.0E-08 |
| sp|C0SJS2|C71AJ_PASSA | Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 | 65 | 409 | 1.0E-08 |
| sp|Q5TCH4|CP4AM_HUMAN | Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 | 104 | 407 | 1.0E-08 |
| sp|Q2LA59|CP21A_LYNLY | Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 | 40 | 409 | 1.0E-08 |
| sp|Q27594|CP6A9_DROME | Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 | 286 | 408 | 1.0E-08 |
| sp|D5JBX1|GAO_BARSP | Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 | 289 | 409 | 1.0E-08 |
| sp|P37123|C77A1_SOLME | Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 | 60 | 409 | 1.0E-08 |
| sp|Q95036|CP6B5_PAPGL | Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 | 279 | 409 | 1.0E-08 |
| sp|P56590|CP1A1_CANLF | Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 | 2 | 409 | 1.0E-08 |
| sp|Q6A152|CP4X1_MOUSE | Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 | 125 | 409 | 1.0E-08 |
| sp|P52786|CP2J1_RABIT | Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 | 179 | 408 | 1.0E-08 |
| sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 154 | 409 | 2.0E-08 |
| sp|Q29552|C11B1_PIG | Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 | 132 | 409 | 2.0E-08 |
| sp|Q43255|C71C2_MAIZE | indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 | 82 | 409 | 2.0E-08 |
| sp|Q50EK3|C04C1_PINTA | Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 | 84 | 409 | 2.0E-08 |
| sp|D5JBW8|GAO_CICIN | Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 | 289 | 409 | 2.0E-08 |
| sp|Q27902|CP6B4_PAPGL | Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 | 279 | 409 | 2.0E-08 |
| sp|Q9SP06|C80B3_PAPSO | (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 | 297 | 409 | 2.0E-08 |
| sp|P43083|CP52V_CANAP | Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 | 125 | 409 | 2.0E-08 |
| sp|Q9CA60|C98A9_ARATH | Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 | 294 | 409 | 2.0E-08 |
| sp|Q9VFP1|CP6D5_DROME | Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 | 111 | 409 | 2.0E-08 |
| sp|P11371|CP2C4_RABIT | Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 | 297 | 407 | 2.0E-08 |
| sp|Q91X77|CY250_MOUSE | Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 | 297 | 407 | 2.0E-08 |
| sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 179 | 408 | 2.0E-08 |
| sp|O64638|C76C3_ARATH | Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 | 159 | 409 | 2.0E-08 |
| sp|P79153|CP11A_CAPHI | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 | 129 | 409 | 2.0E-08 |
| sp|O48786|C734A_ARATH | Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 | 69 | 409 | 2.0E-08 |
| sp|P05177|CP1A2_HUMAN | Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 | 2 | 409 | 2.0E-08 |
| sp|Q9VMS8|C4AC2_DROME | Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 | 259 | 409 | 2.0E-08 |
| sp|Q43078|C97B1_PEA | Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 | 252 | 409 | 3.0E-08 |
| sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 134 | 409 | 3.0E-08 |
| sp|Q55BU9|C5133_DICDI | Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 | 121 | 409 | 3.0E-08 |
| sp|Q8WNE1|CP2F5_GORGO | Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 | 275 | 408 | 3.0E-08 |
| sp|P98188|C94A2_VICSA | Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 | 214 | 409 | 3.0E-08 |
| sp|Q93ZB2|KO1_ARATH | Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 | 255 | 409 | 3.0E-08 |
| sp|Q9LIP6|C71BV_ARATH | Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 | 55 | 409 | 3.0E-08 |
| sp|Q9V769|C6A22_DROME | Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 | 159 | 409 | 3.0E-08 |
| sp|P00179|CP2C5_RABIT | Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 | 297 | 407 | 3.0E-08 |
| sp|P47195|C80A1_BERST | Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 | 104 | 409 | 3.0E-08 |
| sp|Q6WNR0|C81E7_MEDTR | Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 | 183 | 409 | 3.0E-08 |
| sp|Q9V774|C6A21_DROME | Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 | 179 | 408 | 3.0E-08 |
| sp|Q9HCS2|CP4FC_HUMAN | Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 | 286 | 408 | 3.0E-08 |
| sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 297 | 408 | 3.0E-08 |
| sp|P24453|CP1A2_MESAU | Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 | 2 | 409 | 3.0E-08 |
| sp|Q9LTM0|C71BN_ARATH | Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 | 296 | 409 | 3.0E-08 |
| sp|Q9EP75|CP4FE_MOUSE | Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 | 86 | 408 | 4.0E-08 |
| sp|P33263|CP2CQ_MESAU | Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 | 274 | 407 | 4.0E-08 |
| sp|Q9YH64|CP1A1_PLAFE | Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 | 154 | 409 | 4.0E-08 |
| sp|P79202|CP11A_SHEEP | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 | 129 | 409 | 4.0E-08 |
| sp|E1B2Z9|C7AV8_CICIN | Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 | 289 | 409 | 4.0E-08 |
| sp|O48921|C97B2_SOYBN | Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 | 286 | 409 | 4.0E-08 |
| sp|P15123|CP2CG_RABIT | Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 | 297 | 407 | 4.0E-08 |
| sp|Q43240|TCMO_ZINVI | Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 | 197 | 409 | 4.0E-08 |
| sp|Q3LFU0|CP1A1_BALAC | Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 | 2 | 409 | 4.0E-08 |
| sp|Q00557|CP1A1_MESAU | Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 | 2 | 409 | 4.0E-08 |
| sp|P15538|C11B1_HUMAN | Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 | 75 | 409 | 4.0E-08 |
| sp|P15129|CP4B1_RAT | Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 | 283 | 409 | 5.0E-08 |
| sp|Q42600|C84A1_ARATH | Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 | 288 | 409 | 5.0E-08 |
| sp|Q1ZXG6|C5131_DICDI | Probable cytochrome P450 513A1 OS=Dictyostelium discoideum GN=cyp513A1 PE=3 SV=1 | 118 | 409 | 5.0E-08 |
| sp|Q9W130|CP9C1_DROME | Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 | 168 | 409 | 5.0E-08 |
| sp|P37118|C71A2_SOLME | Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 | 162 | 409 | 5.0E-08 |
| sp|D5JBX0|GAO_HELAN | Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 | 289 | 409 | 5.0E-08 |
| sp|Q9FMV7|C94B1_ARATH | Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 | 176 | 408 | 5.0E-08 |
| sp|O42430|CP1A1_LIMLI | Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 | 227 | 409 | 6.0E-08 |
| sp|O65788|C71B2_ARATH | Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 | 296 | 409 | 6.0E-08 |
| sp|P58050|C71BD_ARATH | Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 | 294 | 409 | 6.0E-08 |
| sp|P16141|CP52D_CANMA | Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 | 233 | 409 | 6.0E-08 |
| sp|P05181|CP2E1_HUMAN | Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 | 247 | 408 | 6.0E-08 |
| sp|Q12573|CP52W_CANAP | Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 | 157 | 409 | 6.0E-08 |
| sp|Q2PG45|THAS_MACFA | Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 | 235 | 409 | 6.0E-08 |
| sp|P24465|C71A1_PERAE | Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 | 288 | 409 | 6.0E-08 |
| sp|P51663|C11B1_SHEEP | Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 | 62 | 409 | 6.0E-08 |
| sp|P37117|C71A4_SOLME | Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 | 162 | 409 | 7.0E-08 |
| sp|Q64462|CP4B1_MOUSE | Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 | 283 | 409 | 7.0E-08 |
| sp|Q12586|CP52I_CANMA | Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 | 278 | 409 | 7.0E-08 |
| sp|P79402|CP242_PIG | Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 | 297 | 407 | 7.0E-08 |
| sp|Q948Y1|C719A_COPJA | (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 | 337 | 409 | 7.0E-08 |
| sp|Q9FVS9|C96AF_ARATH | Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 | 287 | 409 | 8.0E-08 |
| sp|Q501D8|C79B3_ARATH | Tryptophan N-monooxygenase 2 OS=Arabidopsis thaliana GN=CYP79B3 PE=1 SV=1 | 14 | 409 | 8.0E-08 |
| sp|P24557|THAS_HUMAN | Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 | 286 | 409 | 8.0E-08 |
| sp|O46515|CP11A_HORSE | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 | 27 | 409 | 8.0E-08 |
| sp|Q9FIB0|C78A7_ARATH | Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 | 160 | 409 | 8.0E-08 |
| sp|Q9VMS9|C4AC1_DROME | Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 | 258 | 409 | 8.0E-08 |
| sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 179 | 408 | 8.0E-08 |
| sp|Q5Z5S6|C7019_ORYSJ | Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 | 295 | 409 | 8.0E-08 |
| sp|Q6GUQ4|CP2E1_MACMU | Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 | 297 | 408 | 8.0E-08 |
| sp|O81345|C79B1_SINAL | Cytochrome P450 79B1 OS=Sinapis alba GN=CYP79B1 PE=2 SV=1 | 179 | 409 | 8.0E-08 |
| sp|P51871|CP4F6_RAT | Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 | 283 | 408 | 9.0E-08 |
| sp|Q9FI39|THAD_ARATH | Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 | 65 | 409 | 9.0E-08 |
| sp|Q9FUY7|C79F2_ARATH | Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2 | 283 | 409 | 1.0E-07 |
| sp|Q0DBF4|C7018_ORYSJ | Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 | 295 | 409 | 1.0E-07 |
| sp|Q27516|C13A8_CAEEL | Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 | 125 | 409 | 1.0E-07 |
| sp|B8NHY4|ORDA_ASPFN | O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 | 266 | 409 | 1.0E-07 |
| sp|Q5VDD6|ORDA_ASPFL | O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 | 266 | 409 | 1.0E-07 |
| sp|P24903|CP2F1_HUMAN | Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 | 249 | 408 | 1.0E-07 |
| sp|Q1ZXF5|C5084_DICDI | Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 | 294 | 409 | 1.0E-07 |
| sp|Q9VGH1|CP315_DROME | Cytochrome P450 315a1, mitochondrial OS=Drosophila melanogaster GN=sad PE=2 SV=1 | 294 | 409 | 1.0E-07 |
| sp|Q8SPK1|CP4AO_PIG | Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 | 273 | 409 | 1.0E-07 |
| sp|P11712|CP2C9_HUMAN | Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 | 273 | 407 | 1.0E-07 |
| sp|P00182|CP2C3_RABIT | Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 | 297 | 407 | 1.0E-07 |
| sp|P14581|CP4A7_RABIT | Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 | 104 | 409 | 1.0E-07 |
| sp|A3A871|C71Z6_ORYSJ | Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 | 279 | 409 | 1.0E-07 |
| sp|Q964R1|CP6J1_BLAGE | Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 | 294 | 409 | 1.0E-07 |
| sp|Q92045|CP11A_DASAM | Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 | 32 | 409 | 1.0E-07 |
| sp|Q27518|C13A2_CAEEL | Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 | 168 | 409 | 1.0E-07 |
| sp|P33260|CP2CI_HUMAN | Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 | 297 | 407 | 1.0E-07 |
| sp|Q9LSF8|C82G1_ARATH | Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 | 149 | 409 | 1.0E-07 |
| sp|P82711|C6A19_DROME | Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 | 124 | 409 | 2.0E-07 |
| sp|Q27664|CP6B2_HELAM | Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 | 291 | 409 | 2.0E-07 |
| sp|Q556M4|C5082_DICDI | Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 | 124 | 409 | 2.0E-07 |
| sp|Q9VG40|CP134_DROME | Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 | 82 | 408 | 2.0E-07 |
| sp|P79716|CP1A1_DICLA | Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 | 16 | 409 | 2.0E-07 |
| sp|Q64391|CP1A2_CAVPO | Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 | 179 | 409 | 2.0E-07 |
| sp|P56655|CP238_MOUSE | Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 | 297 | 407 | 2.0E-07 |
| sp|P58049|C71BB_ARATH | Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 | 288 | 409 | 2.0E-07 |
| sp|A6YIH8|C7D55_HYOMU | Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 | 37 | 409 | 2.0E-07 |
| sp|Q9SMP5|C94B3_ARATH | Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 | 261 | 356 | 2.0E-07 |
| sp|P82713|CP392_DROME | Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 | 260 | 409 | 2.0E-07 |
| sp|P33264|CP2CR_MESAU | Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 | 274 | 407 | 2.0E-07 |
| sp|Q54SN0|C513E_DICDI | Probable cytochrome P450 513E1 OS=Dictyostelium discoideum GN=cyp513E1 PE=3 SV=1 | 281 | 409 | 2.0E-07 |
| sp|Q27519|C13A7_CAEEL | Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 | 60 | 409 | 2.0E-07 |
| sp|P56656|CP239_MOUSE | Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 | 297 | 407 | 2.0E-07 |
| sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 212 | 408 | 2.0E-07 |
| sp|Q08477|CP4F3_HUMAN | Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 | 233 | 409 | 2.0E-07 |
| sp|Q99N16|CP4F3_MOUSE | Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 | 233 | 409 | 2.0E-07 |
| sp|P56594|CP2CL_CANLF | Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 | 297 | 407 | 2.0E-07 |
| sp|Q27712|CP2L1_PANAR | Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 | 297 | 408 | 2.0E-07 |
| sp|O13345|ORDA_ASPPA | O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 | 266 | 409 | 2.0E-07 |
| sp|O48927|C78A3_SOYBN | Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 | 228 | 409 | 2.0E-07 |
| sp|Q42798|C93A1_SOYBN | 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 | 129 | 409 | 2.0E-07 |
| sp|Q08078|CP2CP_MESAU | Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 | 297 | 407 | 2.0E-07 |
| sp|Q9VVN6|CP312_DROME | Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 | 286 | 409 | 2.0E-07 |
| sp|Q54LA8|C555A_DICDI | Probable cytochrome P450 555A1 OS=Dictyostelium discoideum GN=cyp555A1 PE=3 SV=1 | 281 | 409 | 2.0E-07 |
| sp|Q05421|CP2E1_MOUSE | Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 | 232 | 408 | 3.0E-07 |
| sp|P78329|CP4F2_HUMAN | Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 | 233 | 408 | 3.0E-07 |
| sp|Q04468|TCMO_HELTU | Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 | 197 | 409 | 3.0E-07 |
| sp|P51870|CP4F5_RAT | Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 | 286 | 409 | 3.0E-07 |
| sp|P10632|CP2C8_HUMAN | Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 | 296 | 407 | 3.0E-07 |
| sp|P30610|CP52H_CANTR | Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 | 165 | 409 | 3.0E-07 |
| sp|Q5RBQ1|CP1A2_PONAB | Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 | 181 | 409 | 3.0E-07 |
| sp|Q07217|CP11A_ONCMY | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 | 134 | 409 | 3.0E-07 |
| sp|I3PFJ5|C76AD_BETVU | Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 | 297 | 409 | 3.0E-07 |
| sp|Q29527|C11B1_PAPHU | Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 | 125 | 409 | 3.0E-07 |
| sp|Q3MID2|CP4F3_RAT | Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 | 273 | 409 | 4.0E-07 |
| sp|Q54SV9|C515B_DICDI | Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515B1 PE=2 SV=1 | 294 | 409 | 4.0E-07 |
| sp|P58046|C71AF_ARATH | Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 | 168 | 409 | 4.0E-07 |
| sp|P33267|CP2F2_MOUSE | Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 | 212 | 408 | 4.0E-07 |
| sp|O35728|CP4AE_MOUSE | Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 | 104 | 409 | 4.0E-07 |
| sp|Q9SRQ1|C89A9_ARATH | Cytochrome P450 89A9 OS=Arabidopsis thaliana GN=CYP89A9 PE=2 SV=1 | 65 | 409 | 4.0E-07 |
| sp|Q9STK9|C71AO_ARATH | Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 | 296 | 409 | 4.0E-07 |
| sp|O81346|C79B2_ARATH | Tryptophan N-monooxygenase 1 OS=Arabidopsis thaliana GN=CYP79B2 PE=1 SV=2 | 161 | 409 | 4.0E-07 |
| sp|Q27606|CP4E2_DROME | Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 | 125 | 409 | 4.0E-07 |
| sp|Q6NT55|CP4FN_HUMAN | Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 | 286 | 408 | 4.0E-07 |
| sp|F8S1I0|C7BL2_LACSA | Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 | 238 | 409 | 4.0E-07 |
| sp|H2DH22|C7A10_PANGI | Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 | 286 | 409 | 4.0E-07 |
| sp|P37124|C77A2_SOLME | Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 | 294 | 409 | 4.0E-07 |
| sp|Q9LIP5|C71BW_ARATH | Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 | 295 | 409 | 4.0E-07 |
| sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 286 | 409 | 5.0E-07 |
| sp|Q9LMM1|C86A4_ARATH | Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 | 168 | 409 | 5.0E-07 |
| sp|Q64458|CP2CT_MOUSE | Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 | 297 | 407 | 5.0E-07 |
| sp|Q95031|CP6B6_HELAM | Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 | 283 | 409 | 5.0E-07 |
| sp|Q43135|C79A1_SORBI | Tyrosine N-monooxygenase OS=Sorghum bicolor GN=CYP79A1 PE=1 SV=3 | 286 | 409 | 5.0E-07 |
| sp|Q9M7B7|C79D2_MANES | Valine N-monooxygenase 2 OS=Manihot esculenta GN=CYP79D2 PE=1 SV=1 | 248 | 409 | 5.0E-07 |
| sp|B3RFJ6|86A22_PETHY | Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 | 168 | 409 | 5.0E-07 |
| sp|O18963|CP2E1_BOVIN | Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 | 276 | 408 | 5.0E-07 |
| sp|Q9ZU07|C71BC_ARATH | Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 | 297 | 409 | 5.0E-07 |
| sp|P98187|CP4F8_HUMAN | Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 | 286 | 408 | 6.0E-07 |
| sp|P51590|CP2J3_RAT | Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 | 297 | 408 | 6.0E-07 |
| sp|Q949U1|C79F1_ARATH | Dihomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F1 PE=1 SV=1 | 283 | 409 | 6.0E-07 |
| sp|Q06367|CP1A1_CAVPO | Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 | 1 | 409 | 6.0E-07 |
| sp|Q9C5Y2|KAO2_ARATH | Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 | 80 | 409 | 6.0E-07 |
| sp|P37120|C75A2_SOLME | Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 | 169 | 409 | 6.0E-07 |
| sp|Q9Y758|CP52M_DEBHN | Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 | 279 | 409 | 6.0E-07 |
| sp|Q29510|CP2CU_RABIT | Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 | 297 | 407 | 6.0E-07 |
| sp|O65012|C78A4_PINRA | Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 | 154 | 409 | 6.0E-07 |
| sp|Q9CAD6|C86A7_ARATH | Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 | 168 | 409 | 7.0E-07 |
| sp|P33266|CP2E1_MACFA | Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 | 232 | 408 | 7.0E-07 |
| sp|Q54WB9|C513D_DICDI | Probable cytochrome P450 513D1 OS=Dictyostelium discoideum GN=cyp513D1 PE=3 SV=1 | 225 | 409 | 7.0E-07 |
| sp|Q9V9L1|CP6W1_DROME | Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 | 290 | 409 | 7.0E-07 |
| sp|Q92100|CP1A1_PLEPL | Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 | 227 | 409 | 7.0E-07 |
| sp|O65782|C83B1_ARATH | Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 | 295 | 409 | 8.0E-07 |
| sp|P33261|CP2CJ_HUMAN | Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 | 297 | 407 | 8.0E-07 |
| sp|Q947B7|MFS_MENPI | (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 | 294 | 409 | 8.0E-07 |
| sp|Q9EPT4|CP11A_MESAU | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 | 134 | 409 | 8.0E-07 |
| sp|Q54PT3|C556A_DICDI | Probable cytochrome P450 556A1 OS=Dictyostelium discoideum GN=cyp556A1 PE=3 SV=1 | 80 | 409 | 9.0E-07 |
| sp|Q9LTM7|C71BG_ARATH | Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 | 46 | 409 | 9.0E-07 |
| sp|O55071|CP2BJ_MOUSE | Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 | 138 | 408 | 9.0E-07 |
| sp|P58051|C71BE_ARATH | Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 | 295 | 409 | 1.0E-06 |
| sp|P13527|CP6A1_MUSDO | Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 | 179 | 409 | 1.0E-06 |
| sp|Q27520|C13A1_CAEEL | Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 | 125 | 409 | 1.0E-06 |
| sp|O35084|CP27B_MOUSE | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 | 168 | 409 | 1.0E-06 |
| sp|Q9VHP4|CP313_DROME | Probable cytochrome P450 313b1 OS=Drosophila melanogaster GN=Cyp313b1 PE=2 SV=2 | 82 | 406 | 1.0E-06 |
| sp|Q9PUB4|CP26A_CHICK | Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 | 274 | 409 | 1.0E-06 |
| sp|P04798|CP1A1_HUMAN | Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 | 227 | 409 | 1.0E-06 |
| sp|Q9HBI6|CP4FB_HUMAN | Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 | 125 | 409 | 1.0E-06 |
| sp|O49394|C82C2_ARATH | Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 | 168 | 409 | 1.0E-06 |
| sp|P20678|CP2H2_CHICK | Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 | 60 | 407 | 1.0E-06 |
| sp|Q96418|C75A5_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 | 169 | 409 | 1.0E-06 |
| sp|P19099|C11B2_HUMAN | Cytochrome P450 11B2, mitochondrial OS=Homo sapiens GN=CYP11B2 PE=1 SV=3 | 125 | 409 | 1.0E-06 |
| sp|P24456|CP2DA_MOUSE | Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 | 209 | 408 | 1.0E-06 |
| sp|P56592|CP1A2_CANLF | Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 | 6 | 409 | 1.0E-06 |
| sp|Q9LIP4|C71BX_ARATH | Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 | 139 | 409 | 1.0E-06 |
| sp|O35293|CP2F2_RAT | Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 | 294 | 408 | 1.0E-06 |
| sp|P05178|CP2C6_RAT | Cytochrome P450 2C6 OS=Rattus norvegicus GN=Cyp2c6 PE=2 SV=2 | 297 | 407 | 1.0E-06 |
| sp|Q9V3S0|CP4G1_DROME | Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 | 282 | 408 | 1.0E-06 |
| sp|Q05JG2|ABAH1_ORYSJ | Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP707A5 PE=2 SV=1 | 210 | 409 | 1.0E-06 |
| sp|Q09J79|ABAH1_ORYSI | Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. indica GN=CYP707A5 PE=2 SV=1 | 210 | 409 | 1.0E-06 |
| sp|O08336|CYPB_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 | 280 | 409 | 1.0E-06 |
| sp|O04790|C75A7_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 | 169 | 409 | 2.0E-06 |
| sp|P9WPM9|C135B_MYCTU | Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135B1 PE=1 SV=1 | 277 | 409 | 2.0E-06 |
| sp|P9WPM8|C135B_MYCTO | Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135B1 PE=3 SV=1 | 277 | 409 | 2.0E-06 |
| sp|P63716|C135B_MYCBO | Putative cytochrome P450 135B1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp135B1 PE=3 SV=1 | 277 | 409 | 2.0E-06 |
| sp|O80823|C86A8_ARATH | Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 | 168 | 409 | 2.0E-06 |
| sp|P56591|CP1A1_SHEEP | Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 | 227 | 409 | 2.0E-06 |
| sp|P08683|CP2CB_RAT | Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 | 297 | 407 | 2.0E-06 |
| sp|Q9VWR5|CP306_DROME | Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 | 297 | 409 | 2.0E-06 |
| sp|P33262|CP2CK_MACFA | Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 | 296 | 407 | 2.0E-06 |
| sp|Q9V776|CP317_DROME | Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 | 286 | 409 | 2.0E-06 |
| sp|P15150|C11B1_BOVIN | Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 | 62 | 409 | 2.0E-06 |
| sp|P13108|CP2D4_RAT | Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 | 209 | 408 | 2.0E-06 |
| sp|P30609|CP52G_CANTR | Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 | 164 | 360 | 2.0E-06 |
| sp|Q9LTM4|C71BJ_ARATH | Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 | 291 | 409 | 2.0E-06 |
| sp|P00181|CP2C2_RABIT | Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 | 291 | 407 | 2.0E-06 |
| sp|P79739|CP26A_DANRE | Cytochrome P450 26A1 OS=Danio rerio GN=cyp26a1 PE=2 SV=1 | 278 | 409 | 2.0E-06 |
| sp|Q29473|CP2DF_CANLF | Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 | 290 | 408 | 2.0E-06 |
| sp|P24455|CP2A9_MESAU | Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 | 62 | 408 | 2.0E-06 |
| sp|O77809|CP1A2_MACFA | Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 | 179 | 409 | 2.0E-06 |
| sp|P19225|CP270_RAT | Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 | 297 | 407 | 3.0E-06 |
| sp|Q9QUJ1|CP2DS_MESAU | Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 | 209 | 408 | 3.0E-06 |
| sp|A1DA63|FTME_NEOFI | Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 | 298 | 409 | 3.0E-06 |
| sp|O23066|C86A2_ARATH | Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 | 168 | 409 | 3.0E-06 |
| sp|C0SJS4|C71AJ_APIGR | Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 | 245 | 409 | 3.0E-06 |
| sp|P30612|CP52P_CANTR | Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 | 175 | 409 | 3.0E-06 |
| sp|P47787|THAS_PIG | Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 | 235 | 409 | 4.0E-06 |
| sp|O65785|C71B3_ARATH | Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2 | 62 | 409 | 4.0E-06 |
| sp|Q6EIG3|CP26B_DANRE | Cytochrome P450 26B1 OS=Danio rerio GN=cyp26b1 PE=1 SV=1 | 121 | 409 | 4.0E-06 |
| sp|P20814|CP2CD_RAT | Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 | 297 | 407 | 4.0E-06 |
| sp|Q27517|C13A3_CAEEL | Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 | 26 | 409 | 5.0E-06 |
| sp|Q9V419|C28A5_DROME | Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 | 291 | 409 | 5.0E-06 |
| sp|O48923|C71DA_SOYBN | Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 | 61 | 409 | 5.0E-06 |
| sp|Q91W64|CP270_MOUSE | Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 | 297 | 407 | 6.0E-06 |
| sp|Q27513|C13A4_CAEEL | Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 | 125 | 409 | 6.0E-06 |
| sp|O08394|CYPD_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 | 48 | 409 | 6.0E-06 |
| sp|O35132|CP27B_RAT | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 | 168 | 409 | 6.0E-06 |
| sp|O22307|C71DB_LOTJA | Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 | 37 | 409 | 6.0E-06 |
| sp|Q43250|C71C1_MAIZE | 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 | 166 | 409 | 6.0E-06 |
| sp|Q8CIM7|CP2DQ_MOUSE | Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 | 209 | 408 | 6.0E-06 |
| sp|B9DFU2|MAX1_ARATH | Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 | 295 | 409 | 7.0E-06 |
| sp|P24457|CP2DB_MOUSE | Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 | 209 | 408 | 9.0E-06 |
| sp|Q9AXH9|KAO1_HORVU | Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 | 286 | 409 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0004497 | monooxygenase activity | Yes |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
| GO:0005506 | iron ion binding | Yes |
| GO:0020037 | heme binding | Yes |
| GO:0016491 | oxidoreductase activity | No |
| GO:0046906 | tetrapyrrole binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0046872 | metal ion binding | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0043169 | cation binding | No |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 28 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 7 | 29 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|667 MEHLTANAIYCGGAIICVIAVAQYIYAGLTNTLSHVPGPWYTRFTSLPSTAFVILAHHPEWVHALHARYGPVVRI SPHEVDVADPSAAQRIHRARSGFLKSPFYSLLITDSSSVFNEIRPEVHRKYKRLLTGPMSETGLKAFLPRIDGKV RLAIDRMRSENKIRGAADIAKWFMFLSFDIIGDLTFGESFGQLESGRKTQSVDDFVSLGFVGGLRSMFPTIAKIS LFLPIPVFRNATKIQYRTFDYAEKALSRHRTRVEQTGSDLRPTVFSRLYTAEAEETWSPIEIRDNAQVFIVGGSD TTANSMIYLIWAVCKIPQVKAKLLKELEILQQGYGYEDLRDKSYLNCIVNETLRLYTALPAGLPRLVPTGGAELA GHFIPEGATVMTQAYSLHRDENAFPDPYRFYPER* |
| Coding | >Hirsu2|667 ATGGAACACCTCACGGCGAACGCCATCTATTGCGGCGGTGCCATTATATGCGTCATCGCCGTTGCGCAGTACATA TATGCCGGCCTAACAAACACTCTATCCCATGTCCCAGGCCCGTGGTATACGAGATTTACCAGCCTGCCGTCAACC GCATTCGTTATCTTGGCCCATCACCCGGAATGGGTGCACGCCCTCCACGCAAGATATGGCCCCGTCGTGCGCATC AGCCCGCACGAGGTCGACGTCGCGGACCCTTCGGCCGCCCAGCGTATCCACCGTGCCCGGAGCGGCTTCCTAAAG TCCCCTTTCTACTCGCTGCTTATCACCGACTCATCTAGCGTCTTTAACGAGATCAGGCCCGAAGTTCACCGCAAG TACAAGCGTCTCCTCACGGGCCCTATGTCAGAGACGGGCCTCAAGGCCTTCCTACCGCGCATTGACGGGAAAGTA CGCCTCGCCATCGATCGCATGCGCTCTGAGAACAAGATCCGCGGCGCTGCCGACATTGCTAAGTGGTTCATGTTT CTCTCCTTTGATATCATCGGCGACTTGACCTTTGGCGAGTCATTTGGCCAACTTGAGAGCGGCCGAAAGACGCAG TCCGTCGACGACTTCGTAAGCTTGGGCTTCGTGGGCGGCTTGCGCTCCATGTTCCCAACCATTGCCAAAATATCG TTGTTCTTGCCAATACCCGTCTTCAGAAACGCGACCAAGATTCAGTACCGAACTTTTGACTACGCTGAAAAGGCT TTGAGCCGTCATCGCACACGCGTCGAGCAGACAGGCTCCGATCTCCGCCCCACTGTCTTCTCTAGGCTCTACACA GCCGAGGCCGAGGAGACCTGGTCACCCATCGAGATTCGCGACAACGCTCAAGTCTTCATTGTTGGCGGCAGCGAC ACGACGGCGAATTCCATGATATATCTCATTTGGGCCGTCTGCAAGATACCCCAGGTTAAGGCCAAGCTTCTTAAA GAACTCGAAATCCTACAACAGGGCTATGGCTACGAAGATTTAAGGGATAAGTCGTACCTAAACTGCATCGTCAAC GAGACTCTGCGTCTTTACACGGCTCTACCCGCTGGTCTTCCCAGACTCGTACCTACCGGGGGGGCCGAGCTCGCG GGACACTTTATTCCGGAGGGCGCGACCGTCATGACGCAGGCATACAGCTTGCATCGCGACGAGAATGCCTTCCCG GACCCATACCGCTTCTATCCCGAACGCTAG |
| Transcript | >Hirsu2|667 ATGGAACACCTCACGGCGAACGCCATCTATTGCGGCGGTGCCATTATATGCGTCATCGCCGTTGCGCAGTACATA TATGCCGGCCTAACAAACACTCTATCCCATGTCCCAGGCCCGTGGTATACGAGATTTACCAGCCTGCCGTCAACC GCATTCGTTATCTTGGCCCATCACCCGGAATGGGTGCACGCCCTCCACGCAAGATATGGCCCCGTCGTGCGCATC AGCCCGCACGAGGTCGACGTCGCGGACCCTTCGGCCGCCCAGCGTATCCACCGTGCCCGGAGCGGCTTCCTAAAG TCCCCTTTCTACTCGCTGCTTATCACCGACTCATCTAGCGTCTTTAACGAGATCAGGCCCGAAGTTCACCGCAAG TACAAGCGTCTCCTCACGGGCCCTATGTCAGAGACGGGCCTCAAGGCCTTCCTACCGCGCATTGACGGGAAAGTA CGCCTCGCCATCGATCGCATGCGCTCTGAGAACAAGATCCGCGGCGCTGCCGACATTGCTAAGTGGTTCATGTTT CTCTCCTTTGATATCATCGGCGACTTGACCTTTGGCGAGTCATTTGGCCAACTTGAGAGCGGCCGAAAGACGCAG TCCGTCGACGACTTCGTAAGCTTGGGCTTCGTGGGCGGCTTGCGCTCCATGTTCCCAACCATTGCCAAAATATCG TTGTTCTTGCCAATACCCGTCTTCAGAAACGCGACCAAGATTCAGTACCGAACTTTTGACTACGCTGAAAAGGCT TTGAGCCGTCATCGCACACGCGTCGAGCAGACAGGCTCCGATCTCCGCCCCACTGTCTTCTCTAGGCTCTACACA GCCGAGGCCGAGGAGACCTGGTCACCCATCGAGATTCGCGACAACGCTCAAGTCTTCATTGTTGGCGGCAGCGAC ACGACGGCGAATTCCATGATATATCTCATTTGGGCCGTCTGCAAGATACCCCAGGTTAAGGCCAAGCTTCTTAAA GAACTCGAAATCCTACAACAGGGCTATGGCTACGAAGATTTAAGGGATAAGTCGTACCTAAACTGCATCGTCAAC GAGACTCTGCGTCTTTACACGGCTCTACCCGCTGGTCTTCCCAGACTCGTACCTACCGGGGGGGCCGAGCTCGCG GGACACTTTATTCCGGAGGGCGCGACCGTCATGACGCAGGCATACAGCTTGCATCGCGACGAGAATGCCTTCCCG GACCCATACCGCTTCTATCCCGAACGCTAG |
| Gene | >Hirsu2|667 ATGGAACACCTCACGGCGAACGCCATCTATTGCGGCGGTGCCATTATATGCGTCATCGCCGTTGCGGTAGGTGCG ACATATCAATGTGGTCGCGTAGAAGCGCTGTCATATATCTGAATCTTCGGCGGACTAACACCAACGACAATATCC AGCAGTACATATATGCCGGCCTAACAAACACTCTATCCCATGTCCCAGGCCCGTGGTATACGAGATTTACCAGCC TGCCGTCAACCGCATTCGTTATCTTGGCCCATCACCCGGAATGGGTGCACGCCCTCCACGCAAGATATGGCCCCG TCGTGCGCATCAGCCCGCACGAGGTCGACGTCGCGGACCCTTCGGCCGCCCAGCGTATCCACCGTGCCCGGAGCG GCTTCCTAAAGTCCCCTTTCTACTCGCTGCTTATCACCGACTCATCTAGCGTCTTTAACGAGATCAGGCCCGAAG TTCACCGCAAGTACAAGCGTCTCCTCACGGGCCCTATGTCAGAGACGGGCCTCAAGGCCTTCCTACCGCGCATTG ACGGGAAAGTACGCCTCGCCATCGATCGCATGCGCTCTGAGAACAAGATCCGCGGCGCTGCCGACATTGCTAAGT GGTTCATGTTTCTCTCCTTTGATATCATCGGCGACTTGACCTTTGGCGAGTCATTTGGCCAACTTGAGAGCGGCC GAAAGACGCAGTCCGTCGACGACTTCGTAAGCTTGGGCTTCGTGGGCGGCTTGCGCTCCATGTTCCCAACCATTG CCAAAATATCGTTGTTCTTGCCAATACCCGTCTTCAGAAACGCGACCAAGATTCAGTACCGAACTTTTGACTACG CTGAAAAGGCTTTGAGCCGTCATCGCACACGCGTCGAGCAGACAGGCTCCGATCTCCGCCCCACTGTCTTCTCTA GGCTCTACACAGCCGAGGCCGAGGAGACCTGGTCACCCATCGAGATTCGCGACAACGCTCAAGTCTTCATTGTTG GCGGCAGCGACACGACGGCGAATTCCATGATATATCTCATTTGGGCCGTCTGCAAGATACCCCAGGTTAAGGCCA AGCTTCTTAAAGAACTCGAAATCCTACAACAGGGCTATGGCTACGAAGATTTAAGGGATAAGTCGTACCTAAACT GCATCGTCAACGAGACTCTGCGTCTTTACACGGCTCTACCCGCTGGTCTTCCCAGACTCGTACCTACCGGGGGGG CCGAGCTCGCGGGACACTTTATTCCGGAGGGCGCGACCGTCATGACGCAGGCATACAGCTTGCATCGCGACGAGA ATGCCTTCCCGGACCCATACCGCTTCTATCCCGAACGGTGGGAGGCGACGAGCCAACTAATGAAGGATTGTACTA TGCCCTTTGGCGGGGGCTCCAGGAGTAAGCTAG |