Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6668
Gene name
LocationContig_35:13119..14203
Strand+
Gene length (bp)1084
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04442 CtaG_Cox11 Cytochrome c oxidase assembly protein CtaG/Cox11 6.2E-60 94 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19516|COX11_YEAST Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX11 PE=3 SV=2 22 254 6.0E-72
sp|Q86ZU7|CO112_SCHPO Rsm22-cox11 tandem protein 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1102 PE=1 SV=2 66 258 2.0E-63
sp|Q9UTM2|CO111_SCHPO Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1101 PE=1 SV=2 66 258 2.0E-63
sp|A3KMZ6|COX11_BOVIN Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Bos taurus GN=COX11 PE=2 SV=1 34 251 2.0E-61
sp|Q6P8I6|COX11_MOUSE Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Mus musculus GN=Cox11 PE=1 SV=1 34 251 4.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19516|COX11_YEAST Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX11 PE=3 SV=2 22 254 6.0E-72
sp|Q86ZU7|CO112_SCHPO Rsm22-cox11 tandem protein 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1102 PE=1 SV=2 66 258 2.0E-63
sp|Q9UTM2|CO111_SCHPO Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1101 PE=1 SV=2 66 258 2.0E-63
sp|A3KMZ6|COX11_BOVIN Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Bos taurus GN=COX11 PE=2 SV=1 34 251 2.0E-61
sp|Q6P8I6|COX11_MOUSE Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Mus musculus GN=Cox11 PE=1 SV=1 34 251 4.0E-60
sp|Q8GWR0|COX11_ARATH Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Arabidopsis thaliana GN=COX11 PE=2 SV=1 70 250 2.0E-58
sp|Q9Y6N1|COX11_HUMAN Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Homo sapiens GN=COX11 PE=1 SV=3 36 251 3.0E-58
sp|Q54HM6|COX11_DICDI Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Dictyostelium discoideum GN=cox11 PE=3 SV=1 63 251 1.0E-57
sp|O21243|COXZ_RECAM Cytochrome c oxidase assembly protein ctaG OS=Reclinomonas americana GN=CTAG PE=3 SV=1 72 251 2.0E-57
sp|Q5R7U6|COX11_PONAB Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Pongo abelii GN=COX11 PE=3 SV=2 53 251 5.0E-57
sp|Q92IL2|COXZ_RICCN Cytochrome c oxidase assembly protein CtaG OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ctaG PE=3 SV=1 70 251 3.0E-52
sp|Q1RJ56|COXZ_RICBR Cytochrome c oxidase assembly protein CtaG OS=Rickettsia bellii (strain RML369-C) GN=ctaG PE=3 SV=1 70 251 6.0E-52
sp|Q9ZDM3|COXZ_RICPR Cytochrome c oxidase assembly protein CtaG OS=Rickettsia prowazekii (strain Madrid E) GN=ctaG PE=3 SV=1 70 251 1.0E-51
sp|Q4UM75|COXZ_RICFE Cytochrome c oxidase assembly protein CtaG OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ctaG PE=3 SV=1 70 251 1.0E-50
sp|Q985W8|COXZ_RHILO Cytochrome c oxidase assembly protein CtaG OS=Rhizobium loti (strain MAFF303099) GN=ctaG PE=3 SV=1 70 248 3.0E-43
sp|B3PSB4|COXZ_RHIE6 Cytochrome c oxidase assembly protein CtaG OS=Rhizobium etli (strain CIAT 652) GN=ctaG PE=3 SV=1 56 248 1.0E-42
sp|B5ZSV4|COXZ_RHILW Cytochrome c oxidase assembly protein CtaG OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ctaG PE=3 SV=1 71 248 2.0E-42
sp|Q1MKI3|COXZ_RHIL3 Cytochrome c oxidase assembly protein CtaG OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ctaG PE=3 SV=1 71 248 2.0E-42
sp|A6WWG2|COXZ_OCHA4 Cytochrome c oxidase assembly protein CtaG OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ctaG PE=3 SV=1 63 248 4.0E-42
sp|Q92RG6|COXZ_RHIME Cytochrome c oxidase assembly protein CtaG OS=Rhizobium meliloti (strain 1021) GN=ctaG PE=1 SV=1 70 248 6.0E-42
sp|Q2KBM0|COXZ_RHIEC Cytochrome c oxidase assembly protein CtaG OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ctaG PE=3 SV=1 71 248 1.0E-41
sp|Q8G261|COXZ_BRUSU Cytochrome c oxidase assembly protein CtaG OS=Brucella suis biovar 1 (strain 1330) GN=ctaG PE=3 SV=1 70 248 1.0E-41
sp|A9M8Z5|COXZ_BRUC2 Cytochrome c oxidase assembly protein CtaG OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ctaG PE=3 SV=1 70 248 1.0E-41
sp|B0CKF6|COXZ_BRUSI Cytochrome c oxidase assembly protein CtaG OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ctaG PE=3 SV=1 70 248 1.0E-41
sp|Q8YFQ7|COXZ_BRUME Cytochrome c oxidase assembly protein CtaG OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ctaG PE=3 SV=2 70 248 1.0E-41
sp|C0RHH8|COXZ_BRUMB Cytochrome c oxidase assembly protein CtaG OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ctaG PE=3 SV=1 70 248 1.0E-41
sp|A5VP42|COXZ_BRUO2 Cytochrome c oxidase assembly protein CtaG OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ctaG PE=3 SV=1 70 248 1.0E-41
sp|A6U6U8|COXZ_SINMW Cytochrome c oxidase assembly protein CtaG OS=Sinorhizobium medicae (strain WSM419) GN=ctaG PE=3 SV=1 70 248 4.0E-41
sp|Q167V9|COXZ_ROSDO Cytochrome c oxidase assembly protein CtaG OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ctaG PE=3 SV=1 74 249 3.0E-40
sp|C3MHJ5|COXZ_RHISN Cytochrome c oxidase assembly protein CtaG OS=Rhizobium sp. (strain NGR234) GN=ctaG PE=3 SV=1 70 248 1.0E-39
sp|A7IPB8|COXZ_XANP2 Cytochrome c oxidase assembly protein CtaG OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=ctaG PE=3 SV=1 88 251 4.0E-38
sp|Q5LNX9|COXZ_RUEPO Cytochrome c oxidase assembly protein CtaG OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ctaG PE=3 SV=1 89 249 1.0E-37
sp|Q8UHB2|COXZ_AGRFC Cytochrome c oxidase assembly protein CtaG OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ctaG PE=3 SV=2 63 253 3.0E-37
sp|Q5HA73|COXZ_EHRRW Cytochrome c oxidase assembly protein CtaG OS=Ehrlichia ruminantium (strain Welgevonden) GN=ctaG PE=3 SV=1 92 251 9.0E-37
sp|Q5FGG9|COXZ_EHRRG Cytochrome c oxidase assembly protein CtaG OS=Ehrlichia ruminantium (strain Gardel) GN=ctaG PE=3 SV=1 92 251 1.0E-36
sp|Q11KD0|COXZ_CHESB Cytochrome c oxidase assembly protein CtaG OS=Chelativorans sp. (strain BNC1) GN=ctaG PE=3 SV=1 71 248 5.0E-36
sp|A4WQ59|COXZ_RHOS5 Cytochrome c oxidase assembly protein CtaG OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ctaG PE=3 SV=1 91 249 7.0E-36
sp|A1BA38|COXZ_PARDP Cytochrome c oxidase assembly protein CtaG OS=Paracoccus denitrificans (strain Pd 1222) GN=ctaG PE=3 SV=1 80 249 1.0E-35
sp|A4Z2D0|COXZ_BRASO Cytochrome c oxidase assembly protein CtaG OS=Bradyrhizobium sp. (strain ORS278) GN=ctaG PE=3 SV=1 82 251 2.0E-35
sp|A5EAA0|COXZ_BRASB Cytochrome c oxidase assembly protein CtaG OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ctaG PE=3 SV=1 40 251 5.0E-35
sp|B3QF26|COXZ_RHOPT Cytochrome c oxidase assembly protein CtaG OS=Rhodopseudomonas palustris (strain TIE-1) GN=ctaG PE=3 SV=1 88 251 7.0E-35
sp|Q1GE51|COXZ_RUEST Cytochrome c oxidase assembly protein CtaG OS=Ruegeria sp. (strain TM1040) GN=ctaG PE=3 SV=1 89 247 2.0E-34
sp|Q2IR93|COXZ_RHOP2 Cytochrome c oxidase assembly protein CtaG OS=Rhodopseudomonas palustris (strain HaA2) GN=ctaG PE=3 SV=1 61 251 2.0E-34
sp|P56940|COXZ_RHOSH Cytochrome c oxidase assembly protein CtaG OS=Rhodobacter sphaeroides GN=ctaG PE=1 SV=1 81 249 2.0E-34
sp|Q3J5F7|COXZ_RHOS4 Cytochrome c oxidase assembly protein CtaG OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ctaG PE=3 SV=1 81 249 2.0E-34
sp|P08303|COXZ_PARDE Cytochrome c oxidase assembly protein CtaG OS=Paracoccus denitrificans GN=ctaG PE=3 SV=1 80 249 3.0E-34
sp|P56939|COXZ_BRADU Cytochrome c oxidase assembly protein CtaG OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ctaG PE=3 SV=1 82 251 3.0E-34
sp|A3PGX7|COXZ_RHOS1 Cytochrome c oxidase assembly protein CtaG OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ctaG PE=3 SV=1 81 249 5.0E-34
sp|Q13CY3|COXZ_RHOPS Cytochrome c oxidase assembly protein CtaG OS=Rhodopseudomonas palustris (strain BisB5) GN=ctaG PE=3 SV=1 75 251 1.0E-33
sp|Q20X23|COXZ_RHOPB Cytochrome c oxidase assembly protein CtaG OS=Rhodopseudomonas palustris (strain BisB18) GN=ctaG PE=3 SV=1 72 251 1.0E-33
sp|Q1QHV9|COXZ_NITHX Cytochrome c oxidase assembly protein CtaG OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ctaG1 PE=3 SV=1 49 251 2.0E-33
sp|Q07HB0|COXZ_RHOP5 Cytochrome c oxidase assembly protein CtaG OS=Rhodopseudomonas palustris (strain BisA53) GN=ctaG PE=3 SV=1 88 251 1.0E-28
sp|Q04302|COXZ_EHRRU Cytochrome c oxidase assembly protein CtaG OS=Ehrlichia ruminantium GN=ctaG PE=3 SV=1 92 226 2.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 76 98 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6668
MSAVPRAAQRSARSSWARWACAFCRHAPPRSSAVGSVRRQISTSRPNRSPQQQQQQAAAPSMEQIRAHYQRKNRT
VAYYTLSLILGTVALSYGSVPLYKMICQTTGWGGQPVRAHGGSFDGDLSSRLVPVTSAKRIRVTFNASVSDELPW
KFVPQQREVRVLPGETALAFYTAENRGDKDIIGVATYSVTPAQCAPYFSKIQCFCFEEQRLNAGETVDMPVFFYL
DPDLLTDLNMKGVETVTLNYTFFKARYDNNGRFKAPAMI*
Coding >Hirsu2|6668
ATGAGCGCGGTACCACGAGCGGCGCAGCGCTCGGCGCGGAGCAGCTGGGCACGCTGGGCCTGCGCCTTTTGCCGC
CATGCGCCGCCACGGAGCAGCGCCGTCGGCAGCGTGCGGAGGCAAATCTCGACCTCGCGGCCGAACCGGTCACCG
CAGCAGCAACAGCAGCAAGCCGCCGCGCCGTCGATGGAACAGATACGCGCGCACTACCAGAGGAAGAACCGGACG
GTCGCATACTACACCCTCAGCCTGATACTGGGCACGGTGGCGCTGTCGTACGGCTCTGTGCCTCTCTACAAGATG
ATCTGTCAGACGACCGGCTGGGGCGGCCAGCCCGTCCGCGCGCACGGCGGCTCCTTCGACGGCGACCTGTCGAGC
CGGCTGGTGCCGGTGACGTCGGCGAAGCGGATCCGCGTCACCTTCAACGCCTCCGTGTCGGACGAGCTGCCGTGG
AAGTTCGTGCCGCAGCAGCGCGAGGTGCGCGTCCTGCCCGGCGAGACGGCCCTGGCCTTCTACACGGCCGAGAAC
AGGGGCGACAAGGACATCATCGGCGTGGCGACGTACAGCGTGACGCCAGCCCAGTGCGCGCCCTACTTCAGCAAG
ATACAGTGCTTCTGCTTCGAGGAGCAGCGGCTCAACGCCGGCGAGACGGTCGACATGCCCGTCTTCTTCTACCTC
GACCCCGACCTGTTGACGGATCTGAACATGAAGGGCGTCGAGACGGTCACGCTCAACTACACCTTCTTCAAAGCG
AGATACGACAACAACGGCAGGTTCAAGGCACCGGCCATGATATAA
Transcript >Hirsu2|6668
ATGAGCGCGGTACCACGAGCGGCGCAGCGCTCGGCGCGGAGCAGCTGGGCACGCTGGGCCTGCGCCTTTTGCCGC
CATGCGCCGCCACGGAGCAGCGCCGTCGGCAGCGTGCGGAGGCAAATCTCGACCTCGCGGCCGAACCGGTCACCG
CAGCAGCAACAGCAGCAAGCCGCCGCGCCGTCGATGGAACAGATACGCGCGCACTACCAGAGGAAGAACCGGACG
GTCGCATACTACACCCTCAGCCTGATACTGGGCACGGTGGCGCTGTCGTACGGCTCTGTGCCTCTCTACAAGATG
ATCTGTCAGACGACCGGCTGGGGCGGCCAGCCCGTCCGCGCGCACGGCGGCTCCTTCGACGGCGACCTGTCGAGC
CGGCTGGTGCCGGTGACGTCGGCGAAGCGGATCCGCGTCACCTTCAACGCCTCCGTGTCGGACGAGCTGCCGTGG
AAGTTCGTGCCGCAGCAGCGCGAGGTGCGCGTCCTGCCCGGCGAGACGGCCCTGGCCTTCTACACGGCCGAGAAC
AGGGGCGACAAGGACATCATCGGCGTGGCGACGTACAGCGTGACGCCAGCCCAGTGCGCGCCCTACTTCAGCAAG
ATACAGTGCTTCTGCTTCGAGGAGCAGCGGCTCAACGCCGGCGAGACGGTCGACATGCCCGTCTTCTTCTACCTC
GACCCCGACCTGTTGACGGATCTGAACATGAAGGGCGTCGAGACGGTCACGCTCAACTACACCTTCTTCAAAGCG
AGATACGACAACAACGGCAGGTTCAAGGCACCGGCCATGATATAA
Gene >Hirsu2|6668
ATGAGCGCGGTACCACGAGCGGCGCAGCGCTCGGCGCGGAGCAGCTGGGCACGCTGGGCCTGCGCCTTTTGCCGC
CATGCGCCGCCACGGAGCAGCGCCGTCGGCAGCGTGCGGAGGCAAATCTCGACCTCGCGGCCGAACCGGTCACCG
CAGCAGCAACAGCAGCAAGCCGCCGCGCCGTCGATGGAACAGATACGCGCGCACTACCAGAGGAAGAACCGGACG
GTCGCGTGCGTGCGCCTCGCGTGTCCCCTCCGCCCCGGGTTTGCGCTCATGCGTCGGCCAGATACTACACCCTCA
GCCTGATACTGGGCACGGTGGCGCTGTCGTACGGCTCTGTGCCTCTCTACAAGATGGTCGGTCGCCGGAAAGAAA
GAAGGAGAAGGAGAACAAGAAACACACACCGATAACCCCTTCCCTCTTGCGTCGTCATCCTTTCCCCAGCCGGGT
CGACGAGGGAGCCGAGTTTTGTCTCTCCCCCCCGAGCCAGAGCTGACGGGTGCCGAGCAGATCTGTCAGACGACC
GGCTGGGGCGGCCAGCCCGTCCGCGCGCACGGCGGCTCCTTCGACGGCGACCTGTCGAGCCGGCTGGTGCCGGTG
ACGTCGGCGAAGCGGATCCGCGTCACCTTCAACGCCTCCGTGTCGGACGAGCTGCCGTGGAAGTTCGTGCCGCAG
CAGCGCGAGGTGCGCGTCCTGCCCGGCGAGACGGCCCTGGCCTTCTACACGGCCGAGAACAGGGGCGACAAGGAC
ATCATCGGCGTGGCGACGTACAGCGTGACGCCAGCCCAGTGCGCGCCCTACTTCAGCAAGATACAGTGCTTCTGC
TTCGAGGAGCAGCGGCTCAACGCCGGCGAGACGGTCGACATGCCCGTCTTCTTCTACCTCGACCCCGACCTGTTG
ACGGATCTGAACATGAAGGGCGTCGAGACGGTCACGCTCAACTACACCTTCTTCAGTATGTCGACTTGCCCCCGT
TTTTGCTCTTTTCTTCCCGACTTCGACCTTGGGTTTTGCAAGTCTGACACGACCGACAGAAGCGAGATACGACAA
CAACGGCAGGTTCAAGGCACCGGCCATGATATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail