Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6666
Gene name
LocationContig_35:7933..8754
Strand-
Gene length (bp)821
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus 2.6E-21 22 97
PF12352 V-SNARE_C Snare region anchored in the vesicle membrane C-terminus 1.7E-18 135 200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78768|VTI1_SCHPO Vesicle transport v-SNARE protein vti1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vti1 PE=2 SV=2 16 227 2.0E-45
sp|O89116|VTI1A_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1A OS=Mus musculus GN=Vti1a PE=1 SV=1 14 222 2.0E-32
sp|Q9JI51|VTI1A_RAT Vesicle transport through interaction with t-SNAREs homolog 1A OS=Rattus norvegicus GN=Vti1a PE=1 SV=1 14 226 1.0E-31
sp|Q96AJ9|VTI1A_HUMAN Vesicle transport through interaction with t-SNAREs homolog 1A OS=Homo sapiens GN=VTI1A PE=1 SV=2 14 227 2.0E-31
sp|Q9LVP9|VTI13_ARATH Vesicle transport v-SNARE 13 OS=Arabidopsis thaliana GN=VTI13 PE=2 SV=1 11 226 6.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78768|VTI1_SCHPO Vesicle transport v-SNARE protein vti1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vti1 PE=2 SV=2 16 227 2.0E-45
sp|O89116|VTI1A_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1A OS=Mus musculus GN=Vti1a PE=1 SV=1 14 222 2.0E-32
sp|Q9JI51|VTI1A_RAT Vesicle transport through interaction with t-SNAREs homolog 1A OS=Rattus norvegicus GN=Vti1a PE=1 SV=1 14 226 1.0E-31
sp|Q96AJ9|VTI1A_HUMAN Vesicle transport through interaction with t-SNAREs homolog 1A OS=Homo sapiens GN=VTI1A PE=1 SV=2 14 227 2.0E-31
sp|Q9LVP9|VTI13_ARATH Vesicle transport v-SNARE 13 OS=Arabidopsis thaliana GN=VTI13 PE=2 SV=1 11 226 6.0E-29
sp|Q9SEL5|VTI12_ARATH Vesicle transport v-SNARE 12 OS=Arabidopsis thaliana GN=VTI12 PE=1 SV=3 11 226 2.0E-26
sp|Q04338|VTI1_YEAST t-SNARE VTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTI1 PE=1 SV=3 11 227 1.0E-22
sp|Q9SEL6|VTI11_ARATH Vesicle transport v-SNARE 11 OS=Arabidopsis thaliana GN=VTI11 PE=1 SV=2 11 204 6.0E-22
sp|Q54CK6|VTI1A_DICDI Vesicle transport through interaction with t-SNAREs homolog 1A OS=Dictyostelium discoideum GN=vti1A PE=1 SV=1 12 205 1.0E-18
sp|P58200|VTI1B_RAT Vesicle transport through interaction with t-SNAREs homolog 1B OS=Rattus norvegicus GN=Vti1b PE=1 SV=2 28 226 3.0E-18
sp|O88384|VTI1B_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1B OS=Mus musculus GN=Vti1b PE=1 SV=1 28 226 8.0E-18
sp|Q2KIU0|VTI1B_BOVIN Vesicle transport through interaction with t-SNAREs homolog 1B OS=Bos taurus GN=VTI1B PE=2 SV=1 9 226 3.0E-17
sp|Q9UEU0|VTI1B_HUMAN Vesicle transport through interaction with t-SNAREs homolog 1B OS=Homo sapiens GN=VTI1B PE=1 SV=3 28 204 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0016020 membrane Yes
GO:0046907 intracellular transport No
GO:0042886 amide transport No
GO:0008104 protein localization No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0015833 peptide transport No
GO:0015031 protein transport No
GO:0045184 establishment of protein localization No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051649 establishment of localization in cell No
GO:0051641 cellular localization No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 201 223 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6666
MANPLDTDAGSELFASYEAELKLVQADLSQKLDQIPELSGEPRKNAISQAERALEEADELLGQMRLEKQNIPTSS
RAKVNQRFRNYEADVDGNRRKLTALSSDRSALFGSRYRDEPAGASDAHLEQRQQLLSGTDRLDRSTQRLKASQAL
ASETESIGADTLANLHGQREMIQHTHDRLLTSEGYVDRSVKTLRGMARRMATNRVITICIITILVLLIIAVIISK
FR*
Coding >Hirsu2|6666
ATGGCCAACCCGCTCGACACGGACGCTGGCTCCGAGCTGTTCGCCTCCTACGAGGCTGAGCTCAAGCTTGTCCAA
GCCGATCTCTCACAGAAGCTGGACCAGATCCCCGAACTCTCCGGGGAGCCTCGCAAGAACGCCATCAGCCAGGCC
GAACGCGCCCTCGAGGAGGCCGACGAGCTGCTTGGACAGATGCGCCTCGAGAAGCAGAACATTCCCACGTCTTCG
CGCGCCAAGGTCAACCAGCGCTTTCGCAATTATGAAGCCGATGTCGACGGCAACAGACGCAAGCTTACCGCGCTC
TCCTCCGATCGCTCCGCCCTGTTCGGCTCGCGATATCGAGACGAGCCCGCCGGCGCATCGGACGCTCATCTGGAG
CAACGGCAGCAGCTGCTCTCCGGCACAGATCGGCTCGACCGGAGCACGCAGCGGCTGAAAGCCAGCCAGGCGCTT
GCGAGCGAAACGGAGTCCATCGGCGCAGACACCCTCGCAAATCTGCACGGCCAGCGCGAGATGATACAGCATACG
CACGACCGACTTCTGACTAGCGAGGGATACGTGGACAGGAGTGTCAAGACGCTGAGGGGGATGGCGCGGAGAATG
GCTACGAACCGGGTCATCACGATTTGCATCATCACTATTCTTGTGCTTCTCATCATTGCCGTCATCATCAGCAAG
TTCAGATGA
Transcript >Hirsu2|6666
ATGGCCAACCCGCTCGACACGGACGCTGGCTCCGAGCTGTTCGCCTCCTACGAGGCTGAGCTCAAGCTTGTCCAA
GCCGATCTCTCACAGAAGCTGGACCAGATCCCCGAACTCTCCGGGGAGCCTCGCAAGAACGCCATCAGCCAGGCC
GAACGCGCCCTCGAGGAGGCCGACGAGCTGCTTGGACAGATGCGCCTCGAGAAGCAGAACATTCCCACGTCTTCG
CGCGCCAAGGTCAACCAGCGCTTTCGCAATTATGAAGCCGATGTCGACGGCAACAGACGCAAGCTTACCGCGCTC
TCCTCCGATCGCTCCGCCCTGTTCGGCTCGCGATATCGAGACGAGCCCGCCGGCGCATCGGACGCTCATCTGGAG
CAACGGCAGCAGCTGCTCTCCGGCACAGATCGGCTCGACCGGAGCACGCAGCGGCTGAAAGCCAGCCAGGCGCTT
GCGAGCGAAACGGAGTCCATCGGCGCAGACACCCTCGCAAATCTGCACGGCCAGCGCGAGATGATACAGCATACG
CACGACCGACTTCTGACTAGCGAGGGATACGTGGACAGGAGTGTCAAGACGCTGAGGGGGATGGCGCGGAGAATG
GCTACGAACCGGGTCATCACGATTTGCATCATCACTATTCTTGTGCTTCTCATCATTGCCGTCATCATCAGCAAG
TTCAGATGA
Gene >Hirsu2|6666
ATGGCCAACCCGCTCGACACGGACGCTGGCTCCGAGCTGTTCGCCTCCTACGAGGCTGAGCTCAAGCTTGTCCAA
GCCGATCTCTCACAGAAGCTGGACCAGATCCCCGAACTCTCCGGGGAGCCTCGCAAGAACGCCATCAGCCAGGCC
GAACGCGCCCTCGAGGAGGCCGACGAGCTGGTACGCCCCTCCCGGCCACGCCGACCCAGCATCCTGGCCCTCACT
GACGCGCTCGTCCCCTTAACCCCTCCTGTAGCTTGGACAGATGCGCCTCGAGAAGCAGAACATTCCCACGTCTTC
GCGCGCCAAGGTCAACCAGCGCTTTCGCAATTATGAAGCCGATGTCGACGGCAACAGACGCAAGCTTACCGCGCT
CTCCTCCGATCGCTCCGCCCTGTTCGGCTCGCGATATCGAGACGAGCCCGCCGGCGCATCGGACGCTCATCTGGA
GCAACGGCAGCAGCTGCTCTCCGGCACAGATCGGCTCGACCGGAGCACGCAGCGGCTGAAAGCCAGCCAGGCGCT
TGCGAGCGAAACGGAGTCCATCGGCGCAGACACCCTCGCAAATCTGCACGGCCAGCGCGAGATGATACAGCATAC
GCACGACCGACTTCTGACTAGCGAGGGATACGTGGACAGGAGTGTCAAGACGCTGAGGGGGATGGCGCGGAGGTA
ACGTCGACTCCTCGACACAGCGGTTCCGACGGCGCGACTGACCCTCGCTCCATAACAGAATGGCTACGAACCGGG
TCATCACGATTTGCATCATCACTATTCTTGTGCTTCTCATCATTGCCGTCATCATCAGCAAGTTCAGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail