Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6662
Gene name
LocationContig_349:18846..19926
Strand+
Gene length (bp)1080
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10330 Stb3 Putative Sin3 binding protein 2.8E-36 98 183

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7B0|STB3_SCHPO Protein STB3 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stb3 PE=1 SV=2 103 227 2.0E-12
sp|Q12427|STB3_YEAST Protein STB3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STB3 PE=1 SV=1 108 180 1.0E-11
sp|Q750U1|STB3_ASHGO Protein STB3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STB3 PE=3 SV=1 88 192 2.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6662
MASLASAARDIPKAASSNRDNLAVVADRSDSATVARSHTLPTPPNSISPALPAHGLKAQLQKARLEPVESDLDLH
DDADADARSRLPSPAAHDASGAITSALLARHHLPEILLNHGPLAIRHIMGYLTTSVPGFSGIPPTKARRLVVGAL
EGRGGGDGRGSDGGEVDFEKVGWGRWDARRRGFLNARDRQGTPPTLCGAAIPISRTGTRGQDSRARANPPGSVGD
ESLHFSHDDHVMETEADKMSLDDDWASASCSEAPDDDVAMNDDPDDVTDDEDWAAMGAAALRAESYPSMAAAQSG
GDLRTPHFAGGGLRPFSSMSSGMARPPPQPANFDLLALAGTSDAQEREAVEALLRLGSV*
Coding >Hirsu2|6662
ATGGCTTCCCTGGCATCGGCTGCTCGTGACATCCCCAAGGCCGCCTCCTCGAACCGAGACAACTTAGCTGTTGTA
GCGGATCGGAGCGACTCGGCGACTGTGGCACGTTCTCACACCCTCCCGACTCCCCCCAACTCGATATCCCCGGCC
CTTCCCGCACACGGCCTCAAGGCTCAGCTCCAAAAGGCCAGGCTCGAGCCCGTCGAGTCCGACCTGGACCTCCAC
GACGACGCCGACGCCGACGCCCGCAGCAGGCTACCCTCCCCCGCCGCCCACGATGCGTCAGGCGCCATCACCAGC
GCCCTGCTCGCCCGCCACCACCTGCCCGAGATCCTGCTCAACCACGGACCTCTGGCCATCAGGCACATCATGGGC
TACCTGACGACGTCGGTCCCGGGCTTCTCCGGCATCCCCCCCACCAAGGCGCGCAGGCTGGTCGTCGGCGCCCTC
GAGGGCCGAGGAGGGGGCGACGGACGGGGCTCAGACGGAGGAGAGGTCGACTTTGAGAAGGTCGGATGGGGCCGA
TGGGATGCCCGCCGGCGAGGCTTCCTCAACGCCCGCGACCGCCAGGGCACCCCGCCCACACTGTGCGGCGCGGCC
ATCCCCATCTCCCGCACGGGCACGCGCGGCCAGGACAGCCGGGCCCGGGCCAACCCCCCCGGATCCGTCGGCGAC
GAGTCGCTCCACTTCTCCCACGACGACCACGTCATGGAGACCGAGGCCGACAAGATGTCGCTCGACGACGACTGG
GCGTCGGCCTCGTGCTCGGAAGCACCCGACGACGACGTGGCCATGAACGACGACCCCGACGACGTGACCGACGAC
GAGGACTGGGCCGCCATGGGCGCCGCCGCCCTGCGGGCCGAGTCGTATCCCAGCATGGCCGCCGCCCAGTCCGGC
GGCGACCTCCGGACCCCCCACTTCGCCGGCGGAGGACTGCGACCCTTCTCGTCCATGAGCTCCGGCATGGCGCGT
CCACCGCCTCAGCCGGCCAACTTCGACCTGTTGGCGCTGGCCGGCACGTCGGACGCCCAGGAGCGCGAGGCCGTC
GAGGCCCTCCTCCGGCTCGGTTCTGTATAA
Transcript >Hirsu2|6662
ATGGCTTCCCTGGCATCGGCTGCTCGTGACATCCCCAAGGCCGCCTCCTCGAACCGAGACAACTTAGCTGTTGTA
GCGGATCGGAGCGACTCGGCGACTGTGGCACGTTCTCACACCCTCCCGACTCCCCCCAACTCGATATCCCCGGCC
CTTCCCGCACACGGCCTCAAGGCTCAGCTCCAAAAGGCCAGGCTCGAGCCCGTCGAGTCCGACCTGGACCTCCAC
GACGACGCCGACGCCGACGCCCGCAGCAGGCTACCCTCCCCCGCCGCCCACGATGCGTCAGGCGCCATCACCAGC
GCCCTGCTCGCCCGCCACCACCTGCCCGAGATCCTGCTCAACCACGGACCTCTGGCCATCAGGCACATCATGGGC
TACCTGACGACGTCGGTCCCGGGCTTCTCCGGCATCCCCCCCACCAAGGCGCGCAGGCTGGTCGTCGGCGCCCTC
GAGGGCCGAGGAGGGGGCGACGGACGGGGCTCAGACGGAGGAGAGGTCGACTTTGAGAAGGTCGGATGGGGCCGA
TGGGATGCCCGCCGGCGAGGCTTCCTCAACGCCCGCGACCGCCAGGGCACCCCGCCCACACTGTGCGGCGCGGCC
ATCCCCATCTCCCGCACGGGCACGCGCGGCCAGGACAGCCGGGCCCGGGCCAACCCCCCCGGATCCGTCGGCGAC
GAGTCGCTCCACTTCTCCCACGACGACCACGTCATGGAGACCGAGGCCGACAAGATGTCGCTCGACGACGACTGG
GCGTCGGCCTCGTGCTCGGAAGCACCCGACGACGACGTGGCCATGAACGACGACCCCGACGACGTGACCGACGAC
GAGGACTGGGCCGCCATGGGCGCCGCCGCCCTGCGGGCCGAGTCGTATCCCAGCATGGCCGCCGCCCAGTCCGGC
GGCGACCTCCGGACCCCCCACTTCGCCGGCGGAGGACTGCGACCCTTCTCGTCCATGAGCTCCGGCATGGCGCGT
CCACCGCCTCAGCCGGCCAACTTCGACCTGTTGGCGCTGGCCGGCACGTCGGACGCCCAGGAGCGCGAGGCCGTC
GAGGCCCTCCTCCGGCTCGGTTCTGTATAA
Gene >Hirsu2|6662
ATGGCTTCCCTGGCATCGGCTGCTCGTGACATCCCCAAGGCCGCCTCCTCGAACCGAGACAACTTAGCTGTTGTA
GCGGATCGGAGCGACTCGGCGACTGTGGCACGTTCTCACACCCTCCCGACTCCCCCCAACTCGATATCCCCGGCC
CTTCCCGCACACGGCCTCAAGGCTCAGCTCCAAAAGGCCAGGCTCGAGCCCGTCGAGTCCGACCTGGACCTCCAC
GACGACGCCGACGCCGACGCCCGCAGCAGGCTACCCTCCCCCGCCGCCCACGATGCGTCAGGCGCCATCACCAGC
GCCCTGCTCGCCCGCCACCACCTGCCCGAGATCCTGCTCAACCACGGACCTCTGGCCATCAGGCACATCATGGGC
TACCTGACGACGTCGGTCCCGGGCTTCTCCGGCATCCCCCCCACCAAGGCGCGCAGGCTGGTCGTCGGCGCCCTC
GAGGGCCGAGGAGGGGGCGACGGACGGGGCTCAGACGGAGGAGAGGTCGACTTTGAGAAGGTCGGATGGGGCCGA
TGGGATGCCCGCCGGCGAGGCTTCCTCAACGCCCGCGACCGCCAGGGCACCCCGCCCACACTGTGCGGCGCGGCC
ATCCCCATCTCCCGCACGGGCACGCGCGGCCAGGACAGCCGGGCCCGGGCCAACCCCCCCGGATCCGTCGGCGAC
GAGTCGCTCCACTTCTCCCACGACGACCACGTCATGGAGACCGAGGCCGACAAGATGTCGCTCGACGACGACTGG
GCGTCGGCCTCGTGCTCGGAAGCACCCGACGACGACGTGGCCATGAACGACGACCCCGACGACGTGACCGACGAC
GAGGACTGGGCCGCCATGGGCGCCGCCGCCCTGCGGGCCGAGTCGTATCCCAGCATGGCCGCCGCCCAGTCCGGC
GGCGACCTCCGGACCCCCCACTTCGCCGGCGGAGGACTGCGACCCTTCTCGTCCATGAGCTCCGGCATGGCGCGT
CCACCGCCTCAGCCGGCCAACTTCGACCTGTTGGCGCTGGCCGGCACGTCGGACGCCCAGGAGCGCGAGGCCGTC
GAGGCCCTCCTCCGGCTCGGTTCTGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail