Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|666
Gene name
LocationContig_1132:7429..8382
Strand+
Gene length (bp)953
Transcript length (bp)789
Coding sequence length (bp)789
Protein length (aa) 263

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07286|GPT_YEAST UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG7 PE=3 SV=1 18 189 2.0E-37
sp|P42881|GPT_SCHPO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt2 PE=3 SV=1 41 189 2.0E-28
sp|P24140|GPT_CRIGR UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Cricetulus griseus GN=DPAGT1 PE=2 SV=1 41 189 4.0E-19
sp|Q9H3H5|GPT_HUMAN UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Homo sapiens GN=DPAGT1 PE=1 SV=2 41 189 3.0E-18
sp|P23338|GPT_CRILO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Cricetulus longicaudatus GN=DPAGT1 PE=2 SV=1 41 189 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07286|GPT_YEAST UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG7 PE=3 SV=1 18 189 2.0E-37
sp|P42881|GPT_SCHPO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt2 PE=3 SV=1 41 189 2.0E-28
sp|P24140|GPT_CRIGR UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Cricetulus griseus GN=DPAGT1 PE=2 SV=1 41 189 4.0E-19
sp|Q9H3H5|GPT_HUMAN UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Homo sapiens GN=DPAGT1 PE=1 SV=2 41 189 3.0E-18
sp|P23338|GPT_CRILO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Cricetulus longicaudatus GN=DPAGT1 PE=2 SV=1 41 189 5.0E-18
sp|Q5EA65|GPT_BOVIN UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Bos taurus GN=DPAGT1 PE=2 SV=1 41 189 9.0E-18
sp|P42867|GPT_MOUSE UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Mus musculus GN=Dpagt1 PE=1 SV=2 49 189 2.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 85 107 22
3 146 165 19
4 177 199 22
5 219 241 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|666
MAGRGSASNTSLSRSETLSLLSLSVASVAVIANTFRGDGEPLIASFAFSLLAFSLSYGMIRWLGPTFVKAGLRGR
DMGKAHRPEIPECMGAVCAVVYLMTVITFIPFPFYKDIVAATSGGGNRDVVLETRQANLGRFLHRFPHNKLASYL
GAIISLQTVALLGIGDDLFDIRWRHKWWIPGLAAVPLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXRSRCCSPSTTACTC*
Coding >Hirsu2|666
ATGGCGGGCCGCGGCTCGGCGTCGAACACGTCGCTCTCGCGATCCGAGACGCTCTCCCTCCTGTCGCTCTCGGTC
GCCTCCGTCGCCGTCATCGCCAATACGTTCCGCGGCGACGGCGAGCCGCTCATCGCCTCCTTCGCCTTCTCCCTG
CTCGCCTTCTCGCTGAGCTACGGCATGATCCGCTGGCTGGGCCCGACCTTCGTCAAGGCCGGCCTCCGCGGCCGC
GACATGGGCAAGGCCCACCGCCCCGAGATCCCCGAATGCATGGGCGCCGTCTGCGCCGTCGTCTACCTCATGACC
GTCATCACCTTTATCCCCTTTCCCTTCTACAAGGATATCGTGGCCGCCACCAGTGGTGGCGGGAACCGAGACGTC
GTGCTCGAGACGCGGCAGGCTAACCTCGGCCGCTTCCTGCACCGCTTCCCTCACAACAAGCTCGCGTCCTACCTG
GGCGCCATCATCTCGCTGCAGACGGTGGCGCTGCTCGGCATCGGCGACGACCTGTTCGACATACGCTGGCGGCAC
AAGTGGTGGATCCCCGGGCTGGCGGCGGTGCCGCTGCTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCGGTCG
CGCTGCTGCTCGCCCTCAACGACGGCCTGTACCTGCTGA
Transcript >Hirsu2|666
ATGGCGGGCCGCGGCTCGGCGTCGAACACGTCGCTCTCGCGATCCGAGACGCTCTCCCTCCTGTCGCTCTCGGTC
GCCTCCGTCGCCGTCATCGCCAATACGTTCCGCGGCGACGGCGAGCCGCTCATCGCCTCCTTCGCCTTCTCCCTG
CTCGCCTTCTCGCTGAGCTACGGCATGATCCGCTGGCTGGGCCCGACCTTCGTCAAGGCCGGCCTCCGCGGCCGC
GACATGGGCAAGGCCCACCGCCCCGAGATCCCCGAATGCATGGGCGCCGTCTGCGCCGTCGTCTACCTCATGACC
GTCATCACCTTTATCCCCTTTCCCTTCTACAAGGATATCGTGGCCGCCACCAGTGGTGGCGGGAACCGAGACGTC
GTGCTCGAGACGCGGCAGGCTAACCTCGGCCGCTTCCTGCACCGCTTCCCTCACAACAAGCTCGCGTCCTACCTG
GGCGCCATCATCTCGCTGCAGACGGTGGCGCTGCTCGGCATCGGCGACGACCTGTTCGACATACGCTGGCGGCAC
AAGTGGTGGATCCCCGGGCTGGCGGCGGTGCCGCTGCTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCGGTCG
CGCTGCTGCTCGCCCTCAACGACGGCCTGTACCTGCTGA
Gene >Hirsu2|666
ATGGCGGGCCGCGGCTCGGCGTCGAACACGTCGCTCTCGCGATCCGAGACGCTCTCCCTCCTGTCGCTCTCGGTC
GCCTCCGTCGCCGTCATCGCCAATACGTTCCGCGGCGACGGCGAGCCGCTCATCGCCTCCTTCGCCTTCTCCCTG
CTCGCCTTCTCGCTGAGCTACGGCATGATCCGCTGGCTGGGCCCGACCTTCGTCAAGGCCGGCCTCCGCGGCCGC
GACATGGGCAAGGCCCACCGCCCCGAGATCCCCGAATGCATGGGCGCCGTCTGCGCCGTCGTCTACCTCATGACC
GTCATCACCTTTATCCCCTTTCCCTTCTACAAGGATATCGTGGCCGCCACCAGTGGTGGCGGGAACCGAGACGTC
GTGCTCGAGACGCGGCAGGCTAACCTCGGCCGCTTCCTGCACCGCTTCCCTCACAACAAGGTGACAAACATCAAG
CCCTCTTCCGCTCTTCTTTCTTGCAGTCCAATCATGGCAAAAAGACCAAAAAAAACAAAAAAAAACAGGTCAAGG
AAACAATGTTCACATCTCGGCCCACTGTCTCGCCAGCCTTTTCGACTCCGCTGACTTTCTCTCTCCCACGTTAGC
TCGCGTCCTACCTGGGCGCCATCATCTCGCTGCAGACGGTGGCGCTGCTCGGCATCGGCGACGACCTGTTCGACA
TACGCTGGCGGCACAAGTGGTGGATCCCCGGGCTGGCGGCGGTGCCGCTGCTGGTNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNGGCGGTCGCGCTGCTGCTCGCCCTCAACGACGGCCTGTACCTGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail