Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6658
Gene name
LocationContig_349:10327..11578
Strand-
Gene length (bp)1251
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06966 DUF1295 Protein of unknown function (DUF1295) 2.0E-36 69 320

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74507|YJD4_SCHPO Uncharacterized protein C594.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC594.04c PE=3 SV=2 4 325 2.0E-58

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 53 70 17
2 83 102 19
3 161 183 22
4 280 302 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6658
MVLLPVLKSLRDCGDYALTVEPFVAQLYALPARLASIQSLDDLRQLYIETNPLMSAFAASVVLAAVFLLVSEANR
NYSQVDRMWSILPNLYIVHLAIWARLAGLPHSRIDLVAAFSTIWSCRLTFNYWRKGGYQRGSEDYRWQIVKSKVP
GPVFFLFNVTFISFIQSVLLFSFSCAPAYVILLSTRFDPQVTAADVAYFTVQMLLVLSEWFSDGQQWTYQTAKHR
YQKDARLPQGWDQDDLDRGFLTSGLWAYSRHPNFFAEQAIWFVLYHWSCYATNTLFNWSFVGAASLILLFQGSTW
LTEAITSGKYAEYGEYQRQVSMFMPMSFRGYKPPSYKPKVIRTSDLAKRLQNKEKQK*
Coding >Hirsu2|6658
ATGGTGCTCCTCCCAGTTCTCAAGTCCCTCCGGGACTGCGGCGACTATGCTTTGACGGTCGAGCCGTTCGTTGCT
CAGCTCTACGCGCTGCCGGCGCGCCTGGCCAGCATCCAGAGTCTCGACGACTTGAGACAGCTCTACATCGAGACC
AACCCGCTCATGTCCGCCTTTGCAGCCTCCGTCGTGCTCGCCGCCGTTTTCCTGCTCGTGTCCGAGGCGAACCGC
AACTATTCCCAGGTCGACCGCATGTGGAGCATCCTGCCCAATCTCTACATCGTACATCTCGCAATCTGGGCCCGC
CTCGCCGGCCTGCCGCATAGCCGCATCGACCTGGTTGCCGCCTTCAGCACCATCTGGAGCTGCCGCTTGACCTTC
AACTACTGGCGTAAAGGTGGCTATCAGCGTGGATCCGAGGACTACAGATGGCAAATCGTTAAAAGCAAAGTCCCT
GGCCCGGTCTTCTTCCTCTTCAACGTAACCTTCATCTCCTTCATCCAGAGCGTCTTGTTGTTCAGCTTCTCCTGT
GCGCCGGCCTACGTCATCTTGCTTTCGACGCGGTTCGACCCGCAAGTTACAGCGGCCGATGTTGCCTACTTCACC
GTCCAGATGCTTCTCGTGCTCAGCGAATGGTTCAGTGATGGCCAGCAGTGGACATATCAGACCGCCAAGCACCGG
TATCAGAAAGACGCGAGACTGCCGCAGGGCTGGGACCAAGACGATCTCGACCGGGGCTTCTTAACTTCCGGTCTG
TGGGCCTACAGCCGGCATCCCAATTTCTTCGCCGAGCAGGCCATCTGGTTCGTCCTGTACCACTGGAGCTGCTAC
GCCACAAACACCCTGTTCAACTGGTCCTTTGTCGGCGCGGCCAGCTTGATTCTCCTGTTCCAGGGCTCCACGTGG
CTTACCGAGGCAATCACGTCCGGCAAGTACGCGGAATACGGAGAGTACCAGAGGCAAGTCAGCATGTTCATGCCC
ATGTCCTTCCGAGGTTACAAGCCGCCTTCATATAAGCCCAAGGTTATCAGGACAAGCGATCTGGCCAAGCGTCTG
CAGAACAAGGAGAAGCAGAAGTGA
Transcript >Hirsu2|6658
ATGGTGCTCCTCCCAGTTCTCAAGTCCCTCCGGGACTGCGGCGACTATGCTTTGACGGTCGAGCCGTTCGTTGCT
CAGCTCTACGCGCTGCCGGCGCGCCTGGCCAGCATCCAGAGTCTCGACGACTTGAGACAGCTCTACATCGAGACC
AACCCGCTCATGTCCGCCTTTGCAGCCTCCGTCGTGCTCGCCGCCGTTTTCCTGCTCGTGTCCGAGGCGAACCGC
AACTATTCCCAGGTCGACCGCATGTGGAGCATCCTGCCCAATCTCTACATCGTACATCTCGCAATCTGGGCCCGC
CTCGCCGGCCTGCCGCATAGCCGCATCGACCTGGTTGCCGCCTTCAGCACCATCTGGAGCTGCCGCTTGACCTTC
AACTACTGGCGTAAAGGTGGCTATCAGCGTGGATCCGAGGACTACAGATGGCAAATCGTTAAAAGCAAAGTCCCT
GGCCCGGTCTTCTTCCTCTTCAACGTAACCTTCATCTCCTTCATCCAGAGCGTCTTGTTGTTCAGCTTCTCCTGT
GCGCCGGCCTACGTCATCTTGCTTTCGACGCGGTTCGACCCGCAAGTTACAGCGGCCGATGTTGCCTACTTCACC
GTCCAGATGCTTCTCGTGCTCAGCGAATGGTTCAGTGATGGCCAGCAGTGGACATATCAGACCGCCAAGCACCGG
TATCAGAAAGACGCGAGACTGCCGCAGGGCTGGGACCAAGACGATCTCGACCGGGGCTTCTTAACTTCCGGTCTG
TGGGCCTACAGCCGGCATCCCAATTTCTTCGCCGAGCAGGCCATCTGGTTCGTCCTGTACCACTGGAGCTGCTAC
GCCACAAACACCCTGTTCAACTGGTCCTTTGTCGGCGCGGCCAGCTTGATTCTCCTGTTCCAGGGCTCCACGTGG
CTTACCGAGGCAATCACGTCCGGCAAGTACGCGGAATACGGAGAGTACCAGAGGCAAGTCAGCATGTTCATGCCC
ATGTCCTTCCGAGGTTACAAGCCGCCTTCATATAAGCCCAAGGTTATCAGGACAAGCGATCTGGCCAAGCGTCTG
CAGAACAAGGAGAAGCAGAAGTGA
Gene >Hirsu2|6658
ATGGTGCTCCTCCCAGTTCTCAAGTCCCTCCGGGACTGCGGCGACTATGCTTTGACGGTCGAGCCGTTCGTTGCT
CAGCTCTACGCGCTGCCGGCGCGCCTGGCCAGCATCCAGAGTCTCGACGACTTGAGACAGCTCTACATCGAGACC
AACCCGCTCATGTCCGCCTTTGCAGCCTCCGTCGTGCTCGCCGCCGTTTTCCTGCTCGTGTCCGAGGCGAACCGC
AACTATTCCCAGGTCGACCGCATGTGGAGCATCCTGCCCAATCTCTACATCGTACATCTCGCAATCTGGGCCCGC
CTCGCCGGCCTGCCGCATAGCCGCATCGACCTGGTTGCCGCCTTCAGCACCATCTGGAGCGTATGGATGTCCAGG
CACCCCTTCATCGGCCGGCTTCCCGACTGACAGCTTTATTTCAGTGCCGCTTGACCTTCAACTACTGGCGTAAAG
GTGGCTATCAGCGTGGATCCGAGGACTACAGATGGTGAGACTCGGTCGGGACGGAGAGCGTGTGAGCCCGTTCGA
GCTGACGTCGTCTTCTCAGGCAAATCGTTAAAAGCAAAGTCCCTGGCCCGGTCTTCTTCCTCTTCAACGTAACCT
TCATCTCCTTCATCCAGAGCGTCTTGTTGTTCAGCTTCTCCTGTGCGCCGGCCTACGTCATCTTGCTTTCGACGC
GGTTCGACCCGCAAGTTACAGCGGCCGATGTTGCCTACTTCACCGTCCAGATGCTTCTCGTGCTCAGCGAATGGT
TCAGTGATGGCCAGCAGTGGAGTAAGCCTCCAGTCGCTCTTCCTGCCTGCTACGCTCCCGGCACTGACGCTCCCC
CCAGCATATCAGACCGCCAAGCACCGGTATCAGAAAGACGCGAGACTGCCGCAGGGCTGGGACCAAGACGATCTC
GACCGGGGCTTCTTAACTTCCGGTCTGTGGGCCTACAGCCGGCATCCCAATTTCTTCGCCGAGCAGGCCATCTGG
TTCGTCCTGTACCACTGGAGCTGCTACGCCACAAACACCCTGTTCAACTGGTCCTTTGTCGGCGCGGCCAGCTTG
ATTCTCCTGTTCCAGGGCTCCACGTGGCTTACCGAGGCAATCACGTCCGGCAAGTACGCGGAATACGGAGAGTAC
CAGAGGCAAGTCAGCATGTTCATGCCCATGTCCTTCCGAGGTTACAAGCCGCCTTCATATAAGCCCAAGGTTATC
AGGACAAGCGATCTGGCCAAGCGTCTGCAGAACAAGGAGAAGCAGAAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail